KEGG   Bradyrhizobium sp. ORS 278: BRADO0765Help
Entry
BRADO0765         CDS       T00516                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BRADO0765 (recR)
DNA repair and recombination proteins [BR:bra03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BRADO0765 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
810701..811300
Genome map
AA seq 199 aa AA seqDB search
MAVAGPEIERLIQLLARLPGLGPRSARRAALHLIKKREALMVPLASALQVAIDRIQVCKT
CGNIDTQSPCTVCTDPRRDPAMIVVVADVADLWALERAKASNGRYHVLGGTLSPLDGVGP
QDLTIDALVQRAHAPEVSEIILALNATVDGQTTAHYITDLLQEANVKVTRLAHGVPVGGE
LDYLDEGTLSAAMRQRTLF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgccggtcctgaaatcgagcgcctgatccagctgcttgcgcgcctgcccggc
ctcgggccgcgctcggcgcggcgtgccgcgctgcatctgatcaagaagcgcgaggcgctg
atggtgccgctcgcgtcggcgctgcaggtcgcgatcgaccgcatccaggtctgcaagacc
tgcggcaacatcgacacgcagagtccctgcacggtgtgcaccgacccacggcgtgatccc
gcgatgatcgtagtcgtcgccgacgtcgccgatctctgggcgctggagcgcgcgaaggcg
agcaacggccgctatcacgtgctcggcggcaccttgtcgccgctcgacggcgtcggtccg
caggacctcaccatcgacgcgctggtgcagcgcgcgcatgcgccggaggtgtccgagatc
atcctcgcattgaatgcgacggtggatggccagaccacggcgcattacatcaccgacctc
ctgcaggaggcgaacgtcaaggtcacgcggctggcgcatggcgtgccggtcggcggcgag
ctcgactatctcgacgaaggcacgctctcggccgcgatgcggcagcgcaccttgttctaa

DBGET integrated database retrieval system