KEGG   Bradyrhizobium sp. ORS 278: BRADO0774Help
Entry
BRADO0774         CDS       T00516                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BRADO0774 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BRADO0774 (dapE)
Enzymes [BR:bra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BRADO0774 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(819889..821043)
Genome map
AA seq 384 aa AA seqDB search
MTDALTITRDLIRCPSVTPADAGALGVLEALLKQAGFTTHRVTFSEPGTADIDNLYARIG
TEGPHITFAGHTDVVPPGDEASWSLPAFSGEVKDGYIYGRGAVDMKGGIACSVAAALDYL
RDHGSQPKGSISFLITGDEEDVSINGTIKLLQWAADRGETFDHCVLGEPSNQEVMGDCIK
IGRRGSQSGTLIVEGKQGHVAYPHRASNPVPDISRLIVALSDEPLDNGSAQFQPSNLEFT
TVDVGNTATNVIAGIARAKFNIRYNDCHTQESLRALVEQRLAKACGNRIRAHIDWLPSNS
DVFLTKPGPFTDLAVAAIEEVTGRKPELSTTGGTSDARFISSYCPVIEFGLVGQTMHQID
ERASVADIATLTKIYRGILDRYFA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgccctcaccatcacccgcgacctgatccgctgcccctccgtcacccccgcc
gacgccggcgcgctcggcgtgctcgaagccctgctgaaacaggcgggcttcacgacccat
cgcgtgacgttctcggaacccggcaccgcggacatcgacaacctttatgcacgcatcggg
accgaggggccgcacatcaccttcgcgggccacaccgacgtggtgccgccgggcgacgaa
gcctcctggagcctgccggcattctccggcgaggtgaaagacggctacatctatggccgc
ggcgcggtcgacatgaagggcggcatcgcctgcagcgtcgccgcggcgctggactatctc
cgcgaccatggtagccagccgaagggctcgatctcgttcctcatcaccggcgacgaggag
gacgtctcgatcaacggcaccatcaaactactgcaatgggccgccgatcgcggggagaca
ttcgatcattgcgtgctgggtgagccgtccaatcaggaggtcatgggcgactgcatcaag
atcggccgtcgcggctcgcagtcgggcacattgatcgtcgagggcaagcagggccacgtc
gcctacccgcaccgcgcctccaacccggtgccggacatctcgcggctgatcgtggccttg
tcggacgagccgctcgacaatggcagcgcgcaattccagccgtccaatctcgaattcacc
accgtcgacgtcggcaacaccgcgaccaacgtcatcgccggcatcgcgcgggcgaagttc
aacatccgctacaacgactgccatacccaggagtcgctgcgcgcgctggtcgagcagcgc
ctggcaaaagcctgcggcaaccgcatccgcgcccatatcgactggctgccgtcgaactcc
gacgtgttcctgaccaagcccggcccgttcaccgatctcgccgtcgccgccatcgaagag
gtcacgggccgcaagccggagctgtcgaccaccggcggcacctcggacgcgcgtttcatc
tcgtcctattgtccggtgatcgagttcggcctggtcggccagaccatgcatcagatcgac
gagcgcgcctccgtggcggacatcgcgaccttgacgaagatctaccgcggcatcctcgat
cgctacttcgcgtga

DBGET integrated database retrieval system