KEGG   Bradyrhizobium sp. ORS 278: BRADO0819Help
Entry
BRADO0819         CDS       T00516                                 

Gene name
cheB
Definition
chemotaxis response regulator protein CheB-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bra00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BRADO0819 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BRADO0819 (cheB)
Enzymes [BR:bra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BRADO0819 (cheB)
Two-component system [BR:bra02022]
 CheA family
  CheA-CheYBV
   BRADO0819 (cheB)
Bacterial motility proteins [BR:bra02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BRADO0819 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(869982..871076)
Genome map
AA seq 364 aa AA seqDB search
MTKPKIRVLIVDDSASVRQIMTSILGEDPDIEIMGTAADPFAAARRLQNELPDVIVLDIE
MPRMDGLTFLRKIMAQHPIPVVICSAATEQGSQQAFEALEAGAVDIVPKPRVDTRQALLE
ASGRLRDAVKSAARARVRPRAARRPMIEKKLTADAIIPPPVETRTRPTTERIVCIGASTG
GTEALADVLEALPADSPGILIVQHMPPGFTAAFARRLDGLCAIRVKEAEDGEVVQAGCAY
IAPGARHMLLQRMGVRYHIAIKEGPPVSRHRPSVDVLFRSAAQHAGPNALGVIMTGMGDD
GARGLLEMRKLGAATRAQNEESCVVFGMPKEAIALGAAEKVLPLDQIPREILKWHHAGHA
AAAH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacccaagattcgtgtgctgatcgtggacgattccgcgtcggtccggcagatc
atgacctcgatcctcggcgaggaccccgacatcgagatcatgggcacggccgccgatccg
tttgccgccgcccgccgcctgcagaacgagctgcccgacgtcatcgtgctcgacatcgag
atgccgcgcatggacggcctcaccttcctgcgcaagatcatggcgcagcatccgatcccg
gtcgtgatctgctccgccgcgacagaacagggatcgcagcaggcattcgaagcgttggag
gcgggtgccgtggacatcgtcccgaagccgcgcgtcgacacgaggcaggcgctgctggaa
gcgtccgggcggctgcgcgatgcggtgaaatcggccgcgcgtgcccgcgtccggccgcgt
gccgcgcgccgtcccatgatcgagaagaagctgacggccgatgcgatcattccgccgccg
gtggagacgcggacgcgcccgaccaccgagcgcatcgtctgcatcggcgcatcgaccggc
ggcaccgaagcgctcgccgacgtgctcgaggcgctgcccgccgacagccccggcatcctc
atcgtgcagcacatgccgcccggcttcaccgcggccttcgctcgtcgcctggacggcctc
tgtgccatccgcgtcaaggaggccgaagacggcgaggtggtgcaggccggctgcgcctat
atcgcgccgggagcccgccacatgctgctgcagcgtatgggcgtgcgctatcacatcgcc
atcaaggaaggacctccggtctcgcgccaccggccctctgtcgacgtgctgttccgatct
gccgcgcaacatgcgggacccaacgcgctcggcgtgatcatgaccggaatgggcgacgat
ggcgcgcgcggcctgttggagatgcgcaagctcggcgccgcgacgcgtgcgcagaacgag
gagagctgcgtcgtgttcggcatgccgaaggaggccatcgccctcggcgcggccgagaag
gtgttgccgctcgaccagatccctcgcgagatcctcaagtggcatcacgcaggccacgcc
gccgccgcgcattga

DBGET integrated database retrieval system