KEGG   Bradyrhizobium sp. ORS 278: BRADO0860Help
Entry
BRADO0860         CDS       T00516                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bra00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
911520..913289
Genome map
AA seq 589 aa AA seqDB search
MCGICGEIRHSGQPALAALSLVNDAMQARGPDAAGLYVQGGIALGHRRLSILDLSSAAQQ
PMIDAALGLGIAFNGCIYNFRELRTELKAKGYRFFSDGDTEVILKAYHAWGKNCVQRFKG
MFAFALWERDCGRVVIARDRLGIKPLYYTEGDGFFRFASSLPALLAGGGVDTSLDLTALH
HFFSFHAAVPAPRTILNGVKKLEPATLLTIEPDGTRRRERYWHFNVGEQRPTDRAMTADE
WSEAVLDAMTAAVDRRRVADVPVGVLLSGGLDSSLLVALLSKLGHQDIRTFSIGFDAVGG
HSGDEFRYSDIIARTFGTNHEQIRIGGHRALEALPHAIAAMSEPMVSHDAVAFHLLSSEV
AKRVKVVQSGQGADEVFGGYSWYPGFLSANDPVQSYQSTYFDWQHADLQRLLLPDMLGDD
VSLAFVERFFAEHGGAAVDKVLQIDAEIMLVDDPVKRVDNMTMAFGLEARVPFLDHDVVE
LAARIPAELKVKNGGKHILKEAARRCVPAEVIDRPKGYFPVPSLRYLRGPFLDYVRDVLS
DDKARTRGLYQRDFVDHMLQNPEAEMSPKGHSRLWQAALLEAWLQTHGI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatttgtggtgaaatcaggcattccggccagcccgcgctcgcggcgctcagc
ctggtcaacgatgcgatgcaggcgcggggacccgatgcggccggactctatgtccagggc
gggatcgcactgggacatcggcgtctgagcatcctcgatctctcctccgccgcgcagcag
ccgatgatcgatgccgcgctcgggctcggtatcgcattcaacggctgcatctataacttc
cgcgagctgcgcaccgagctgaaggcgaagggctatcgcttcttctccgacggcgacacg
gaagtcatcctcaaggcctatcacgcctggggcaagaactgcgtgcaacgcttcaagggc
atgtttgcttttgcgctctgggagcgcgactgcgggcgtgtcgtgatcgcgcgcgaccgg
ctcggcatcaagccgctctattacaccgaaggtgacggcttctttcgattcgcgtcgtcc
ctgccggcgctgctcgccggtggcggagtcgacacctcgctggatctcacggcgctgcac
cacttcttcagctttcacgcggccgttcccgccccgcgcacgatcctcaacggcgtgaag
aagctcgagccggcgacgctgctgaccatcgagccggacggcacgcggcgtcgcgagcgc
tattggcacttcaatgtcggcgagcagcgcccgacggatcgggccatgactgccgatgaa
tggtcggaggcggtgctggatgcaatgacggcggccgtcgaccgacgccgggtcgccgac
gtgcccgtgggcgtgctgctgtccggcgggctcgattcgtcgctgctggtcgcactgctg
tccaagctcggccaccaggacatccgcaccttctcgatcggcttcgatgctgtgggcggg
cacagcggcgatgagtttcgctactcggacatcatcgcgcgcacgtttggtacaaatcac
gagcagatcaggatcggcggccatcgcgcgctcgaggcgctgccgcatgcgatcgccgcg
atgtcggagccgatggtcagccatgacgcggttgcgttccatctcttgtcctcggaggtc
gccaagcgggtcaaggtggtgcagagcgggcagggcgccgacgaggtgttcggcggctac
agctggtaccccggcttcctctcggcgaacgatccggtgcagtcatatcagagcacctat
ttcgattggcagcatgcggacctgcagcggctgctgttgccggacatgctcggcgacgat
gtcagcctcgcattcgtcgagcgcttcttcgccgaacacggcggtgccgcggtcgacaag
gtgctgcagatcgacgccgagatcatgctggtcgacgaccccgtgaagcgggtcgacaac
atgacgatggcgttcggactggaagcgcgcgtgccattcctcgatcacgacgtggtcgag
ctcgccgcgcgcatcccggccgagctgaaggtaaagaacggcggtaagcatatcctgaag
gaggccgcgcgacgctgcgtgccggcggaggtgatcgaccgtccgaaaggctatttcccg
gtgccgtcattgcgctatctgcgcgggccattcctcgactatgtgcgtgacgtgctgagc
gacgacaaggcgcgcacgcgcggtctctaccaacgtgatttcgtcgaccacatgctgcag
aacccggaagccgagatgagcccgaagggccattcgcgcctctggcaggcggctctgctg
gaagcctggctgcagacgcacggcatttga

DBGET integrated database retrieval system