KEGG   Bradyrhizobium sp. ORS 278: BRADO0860Help
Entry
BRADO0860         CDS       T00516                                 

Definition
(GenBank) Putative asparagine synthetase [glutamine-hydrolyzing]
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00250  Alanine, aspartate and glutamate metabolism
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRADO0860
Enzymes [BR:bra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BRADO0860
Peptidases [BR:bra01002]
 Cysteine Peptidases
  Family C44
   BRADO0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: CAL74779
RhizoBase: BRADO0860
UniProt: A4YLK3
Position
911520..913289
Genome map
AA seq 589 aa AA seqDB search
MCGICGEIRHSGQPALAALSLVNDAMQARGPDAAGLYVQGGIALGHRRLSILDLSSAAQQ
PMIDAALGLGIAFNGCIYNFRELRTELKAKGYRFFSDGDTEVILKAYHAWGKNCVQRFKG
MFAFALWERDCGRVVIARDRLGIKPLYYTEGDGFFRFASSLPALLAGGGVDTSLDLTALH
HFFSFHAAVPAPRTILNGVKKLEPATLLTIEPDGTRRRERYWHFNVGEQRPTDRAMTADE
WSEAVLDAMTAAVDRRRVADVPVGVLLSGGLDSSLLVALLSKLGHQDIRTFSIGFDAVGG
HSGDEFRYSDIIARTFGTNHEQIRIGGHRALEALPHAIAAMSEPMVSHDAVAFHLLSSEV
AKRVKVVQSGQGADEVFGGYSWYPGFLSANDPVQSYQSTYFDWQHADLQRLLLPDMLGDD
VSLAFVERFFAEHGGAAVDKVLQIDAEIMLVDDPVKRVDNMTMAFGLEARVPFLDHDVVE
LAARIPAELKVKNGGKHILKEAARRCVPAEVIDRPKGYFPVPSLRYLRGPFLDYVRDVLS
DDKARTRGLYQRDFVDHMLQNPEAEMSPKGHSRLWQAALLEAWLQTHGI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatttgtggtgaaatcaggcattccggccagcccgcgctcgcggcgctcagc
ctggtcaacgatgcgatgcaggcgcggggacccgatgcggccggactctatgtccagggc
gggatcgcactgggacatcggcgtctgagcatcctcgatctctcctccgccgcgcagcag
ccgatgatcgatgccgcgctcgggctcggtatcgcattcaacggctgcatctataacttc
cgcgagctgcgcaccgagctgaaggcgaagggctatcgcttcttctccgacggcgacacg
gaagtcatcctcaaggcctatcacgcctggggcaagaactgcgtgcaacgcttcaagggc
atgtttgcttttgcgctctgggagcgcgactgcgggcgtgtcgtgatcgcgcgcgaccgg
ctcggcatcaagccgctctattacaccgaaggtgacggcttctttcgattcgcgtcgtcc
ctgccggcgctgctcgccggtggcggagtcgacacctcgctggatctcacggcgctgcac
cacttcttcagctttcacgcggccgttcccgccccgcgcacgatcctcaacggcgtgaag
aagctcgagccggcgacgctgctgaccatcgagccggacggcacgcggcgtcgcgagcgc
tattggcacttcaatgtcggcgagcagcgcccgacggatcgggccatgactgccgatgaa
tggtcggaggcggtgctggatgcaatgacggcggccgtcgaccgacgccgggtcgccgac
gtgcccgtgggcgtgctgctgtccggcgggctcgattcgtcgctgctggtcgcactgctg
tccaagctcggccaccaggacatccgcaccttctcgatcggcttcgatgctgtgggcggg
cacagcggcgatgagtttcgctactcggacatcatcgcgcgcacgtttggtacaaatcac
gagcagatcaggatcggcggccatcgcgcgctcgaggcgctgccgcatgcgatcgccgcg
atgtcggagccgatggtcagccatgacgcggttgcgttccatctcttgtcctcggaggtc
gccaagcgggtcaaggtggtgcagagcgggcagggcgccgacgaggtgttcggcggctac
agctggtaccccggcttcctctcggcgaacgatccggtgcagtcatatcagagcacctat
ttcgattggcagcatgcggacctgcagcggctgctgttgccggacatgctcggcgacgat
gtcagcctcgcattcgtcgagcgcttcttcgccgaacacggcggtgccgcggtcgacaag
gtgctgcagatcgacgccgagatcatgctggtcgacgaccccgtgaagcgggtcgacaac
atgacgatggcgttcggactggaagcgcgcgtgccattcctcgatcacgacgtggtcgag
ctcgccgcgcgcatcccggccgagctgaaggtaaagaacggcggtaagcatatcctgaag
gaggccgcgcgacgctgcgtgccggcggaggtgatcgaccgtccgaaaggctatttcccg
gtgccgtcattgcgctatctgcgcgggccattcctcgactatgtgcgtgacgtgctgagc
gacgacaaggcgcgcacgcgcggtctctaccaacgtgatttcgtcgaccacatgctgcag
aacccggaagccgagatgagcccgaagggccattcgcgcctctggcaggcggctctgctg
gaagcctggctgcagacgcacggcatttga

DBGET integrated database retrieval system