KEGG   Bradyrhizobium sp. ORS 278: BRADO1001Help
Entry
BRADO1001         CDS       T00516                                 

Definition
(GenBank) Cytochrome c homolog
  KO
K08738  cytochrome c
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra01100  Metabolic pathways
bra01120  Microbial metabolism in diverse environments
bra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BRADO1001
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BRADO1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: CAL74916
RhizoBase: BRADO1001
UniProt: A4YLZ0
Position
1066477..1067025
Genome map
AA seq 182 aa AA seqDB search
MDSFELNKILGAVLAACLVVLVTSFSANAIFAPKMPEKPGFEIAVKEAEGASKEAAAPAS
AEPIEKLLQTASVEKGAAAAKKCAACHTFAKGEKNGVGPNLWGVVGDKIGEGRGFNWSQA
IKAKGGTWTIEELNKFITNPKGYIPGTAMGFAGIQKDSERADVLAYLNSLSDNPAPLPTA
AK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggactccttcgaactgaacaaaatcctcggcgccgtgctggccgcctgtctggtcgtg
ctggtcacgagcttttccgccaacgcgatcttcgcgccgaagatgccggaaaagccgggt
ttcgagatcgccgtgaaggaggccgaaggcgcaagcaaggaagccgctgcgccggcctcc
gccgagccgatcgagaagctgctgcagaccgcctccgtcgagaagggcgccgccgccgcc
aagaagtgcgcagcctgccacacctttgcgaagggcgagaagaacggcgtcggcccgaac
ctctggggcgtggtcggcgacaagatcggcgagggccgcggcttcaactggtcgcaggcg
atcaaggccaagggcggcacctggacgatcgaagagctgaacaagttcatcaccaacccc
aaggggtacatcccgggcaccgccatgggcttcgccggcatccagaaggactcggagcgc
gccgacgtgctggcctatctgaactcgctctcggacaacccggccccgctgccgaccgca
gccaagtga

DBGET integrated database retrieval system