KEGG   Bradyrhizobium sp. ORS 278: BRADO1001Help
Entry
BRADO1001         CDS       T00516                                 

Definition
cytochrome c-like protein
Orthology
K08738  
cytochrome c
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bra00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bra02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1066477..1067025
Genome map
AA seq 182 aa AA seqDB search
MDSFELNKILGAVLAACLVVLVTSFSANAIFAPKMPEKPGFEIAVKEAEGASKEAAAPAS
AEPIEKLLQTASVEKGAAAAKKCAACHTFAKGEKNGVGPNLWGVVGDKIGEGRGFNWSQA
IKAKGGTWTIEELNKFITNPKGYIPGTAMGFAGIQKDSERADVLAYLNSLSDNPAPLPTA
AK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggactccttcgaactgaacaaaatcctcggcgccgtgctggccgcctgtctggtcgtg
ctggtcacgagcttttccgccaacgcgatcttcgcgccgaagatgccggaaaagccgggt
ttcgagatcgccgtgaaggaggccgaaggcgcaagcaaggaagccgctgcgccggcctcc
gccgagccgatcgagaagctgctgcagaccgcctccgtcgagaagggcgccgccgccgcc
aagaagtgcgcagcctgccacacctttgcgaagggcgagaagaacggcgtcggcccgaac
ctctggggcgtggtcggcgacaagatcggcgagggccgcggcttcaactggtcgcaggcg
atcaaggccaagggcggcacctggacgatcgaagagctgaacaagttcatcaccaacccc
aaggggtacatcccgggcaccgccatgggcttcgccggcatccagaaggactcggagcgc
gccgacgtgctggcctatctgaactcgctctcggacaacccggccccgctgccgaccgca
gccaagtga

DBGET integrated database retrieval system