KEGG   Bradyrhizobium sp. ORS 278: BRADO1059Help
Entry
BRADO1059         CDS       T00516                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRADO1059 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRADO1059 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BRADO1059 (glcB)
Enzymes [BR:bra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BRADO1059 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1123808..1125982)
Genome map
AA seq 724 aa AA seqDB search
MTRIDAHGLKIAPVLFDFITKEAAPKTGIDPDAFWAGVAAILRDLGSKNRELLKFRDTLQ
DKIDAWHLANKGKAFDLGAYTAFLKEIGYLLPEPATQKVETANVDDEIGKICGPQLVVPL
TNARYALNAANARWGSLYDAFYGTDAIPHDPSEGGKGYNKARGDKVIAKAKAFLDAAAPL
ATGSHTDVTAYSVIAGQLSAKLKSGNATALKNAGQFAGYQGSAEAPSVILLANNGLHVEV
VIDRSHVIGKDDPAGVSDMILEAAVSTILDMEDSVAAVDAEDKVLVYRNTLGLMNGTLSA
DFEKGGKTLTRALNSDRSYTTPSGGTLALHGRSLLLIRNCGHHMFTDAVLGADGEEIPEG
ILDAAVTGLLAIHDLKGHSKVKNSRTGSIYIVKPKMHGPDEVALTVELFARVEKMLGLPE
NTMKVGIMDEERRTTVNLKACIQQASKRIVFINTGFLDRTGDEIHTSMEAGPMIRKNEMK
AQPWIKAYEDWNVDMGLIDGLPGHAQIGKGMWAAPDKMADMLAQKIGHPSAGATTAWVPS
PTAATLHALHYHQVNVKARQDELTKGGPRAKLGDILTIPVSNSNWAPDDVRQEIDNNCQG
ILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVSKDQVMDSLKR
MAVVVDKQNAGDPLYQPMAPSFDGVAFKAACDLVFEGRTQPNGYTEYILTARRREAKASE
TAKA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgacgcccatggactgaagatcgcccccgtcctgttcgacttcatcacc
aaggaggcggcgccgaagaccgggatcgatccggacgcgttctgggccggcgtggccgcg
atcctgcgcgatctcgggtccaaaaaccgcgaattgctcaaattccgcgatacgctgcag
gacaagatcgacgcctggcacctcgccaacaagggcaaggcgttcgacctcggcgcctac
acggcgttcttgaaggagatcggctacctcctgccggagcccgcgacccagaaggtcgag
acggccaacgttgacgacgagatcggcaagatctgcggtccccaactcgtggtgccgctg
accaacgcccgctacgcgctgaatgcggccaatgcgcgctggggttcgctgtacgacgcc
ttctacggcaccgacgccatcccgcatgatccgagcgagggcggaaagggctataacaag
gccaggggcgacaaggtgatcgccaaggccaaggcgttcctcgacgccgccgcgccgctc
gccaccggcagccacaccgacgtcaccgcctacagcgtcattgctgggcaactgtccgcc
aagctgaagagcggcaacgccactgcactgaagaacgccggtcagttcgccggctaccag
ggctcggccgaggcgccgtccgtgatcctgctcgccaacaatggcctgcatgtcgaggtc
gtgatcgaccgcagccacgtcatcggcaaggacgacccggccggcgtctccgacatgatc
ctggaagccgcggtctcgaccatcctcgacatggaggactcggtcgccgccgtcgacgcc
gaggacaaggtgctggtctatcgcaacacgctcggcctgatgaacggcacgctgtcggcc
gatttcgagaagggcggcaagacgctcacgcgcgccttgaacagcgaccgcagctacacg
acgccgtccggcggcacgctcgctttacacggccgcagcctgctgctgatccgcaactgc
ggacatcacatgttcaccgacgccgtgctcggcgccgacggcgaggaaattccggagggc
attctcgacgccgccgtcaccggcctgctggcgatccacgacctcaagggccactccaag
gtcaagaacagccgcaccggctcgatttacatcgtcaagccgaagatgcacggccccgac
gaggtcgcgctgacggtcgagctgttcgcgcgcgtcgaaaagatgctcggcctgccggag
aacaccatgaaggtcggcatcatggacgaggagcgccgcaccacggtcaacctcaaggcc
tgcatccagcaggcctccaagcgcatcgtgttcatcaacaccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaagcgggtccgatgatccgcaagaacgagatgaag
gcgcagccctggatcaaggcctatgaggactggaacgtcgacatgggcctgatcgacggc
ctgcccggccacgcccagatcggcaagggcatgtgggcggcgccggacaagatggcggac
atgctggcgcagaagatcggccacccctccgccggcgccaccactgcctgggtgccgtcg
ccgacggcggcgaccttgcatgccctgcactatcaccaggtcaatgtgaaggctcggcag
gacgaactgacaaagggcgggccgcgcgccaagctcggcgacatcctcaccatccccgtg
tcgaactcgaactgggcgccggacgacgtccgccaggagatcgacaacaactgccagggt
attctcggctacgtcgtgcgctggatcgaccagggcgtcggctgctccaaggtgcctgat
atccacgatgtcggcctgatggaagaccgcgcaacgttgcgcatctccagccagcatctc
gccaactggctgcatcatggcgtggtcagcaaggaccaggtgatggattcgctgaagcgc
atggcggtggtggtggacaagcagaacgccggcgatccgctgtatcagccgatggcacca
tcgttcgacggagtggcgttcaaggcggcctgcgacctggtgttcgaaggccggacgcag
ccgaatggctataccgagtacatcctcaccgcgcggcggcgcgaagccaaagccagcgag
acggcgaaggcctga

DBGET integrated database retrieval system