KEGG   Bradyrhizobium sp. ORS 278: BRADO1062Help
Entry
BRADO1062         CDS       T00516                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BRADO1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1128696..1129553
Genome map
AA seq 285 aa AA seqDB search
MHTAVATPAPAHQARIRHAAAAPRTPNHKTPPVAAATAPETPAAEPITVGAAATPPGQLS
EAELAAKGLALFNDASLSGGSKASCATCHFSTGHTNNKTYVGLDAVADGDPNGRNTPTLW
GVGERSVFGWQGQAATLEDSIRGIIVNRMKGPDPSKETLAALVAYVKTLNYPANWQVRED
GTPRDDASPAVKRGFELYVGDGGCGTCHQLSTFDKKSRDDIGTGGKFKVPALRAVASTAP
YFHDGRTASLRDAVKLMWEVYAKKMESRLPTEAELDDLTAYVGAL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcacacggcggtggccacgccggcccccgcgcatcaagccaggatcaggcacgcggcc
gcggcgccgcgcacgccgaaccacaagactccgccggttgctgctgcgacggcgccggag
acacctgccgcggagccgataacggtgggggccgccgccacgccgcccggacagctctcc
gaggccgagcttgccgccaaggggctggcgctgttcaacgatgccagcctgtcgggcggc
agcaaggcctcctgcgcgacctgtcacttctcgaccgggcataccaacaacaagacctat
gtcggcctcgacgcggtcgccgatggcgatcccaacggccgcaatacgccgaccctgtgg
ggcgtcggcgagcgatcggtgttcggctggcagggccaggccgcgacgctggaggacagc
atccgcggcatcatcgtcaaccgcatgaaggggccggatccgtcgaaggagaccctcgcg
gcgctggtcgcatatgtgaagacgctgaactatccggcgaactggcaggtcagagaggac
ggcaccccgcgcgacgatgcgagcccggcggtcaagcgcggcttcgagctctatgtcggc
gacggcggctgcggcacctgccaccagctgtcgaccttcgacaagaagagccgcgacgac
atcggcaccggcggcaagttcaaggtgccggcgctgcgcgcggtggcgtcgaccgcgccc
tatttccacgacggccgcacggcctcgctgcgcgacgcggtcaagctgatgtgggaggtc
tacgccaagaagatggaatcgcggctgccgacggaggccgaactcgacgatctcacggcg
tatgtcggggcgctctga

DBGET integrated database retrieval system