KEGG   Bradyrhizobium sp. ORS 278: BRADO1076Help
Entry
BRADO1076         CDS       T00516                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BRADO1076
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BRADO1076
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BRADO1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1143687..1144478
Genome map
AA seq 263 aa AA seqDB search
MTTNLKGKTAVVTGSTSGIGLAIARGFASAGANIVLNGFGAPDDIEKERASIESEFKVKA
VHSPADMSKPAEIAGMIALGESTFGSVDVLVNNAGIQFVSPVEDFPPEKWEQIIAINLSS
AFYGIHAAVPGMKKRGWGRIINTASAHSLVASPFKSAYVSAKHGIAGLTKTVALELATFK
ITCNCISPGYVWTPLVEKQIPDTMKARNLTKEQVIHDVLLAAQPTKEFVTVDQVAALALF
LCSDEAAQITGTNLSIDGGWTAE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaatttgaagggcaagaccgcggtggttaccggctcgaccagcggcatcggg
cttgcgatcgcccgcggcttcgcctcggccggcgccaacatcgtgctcaacggcttcggc
gcgcccgatgacatcgagaaggagcgcgccagcatcgagagcgagttcaaggtgaaggcg
gtgcactcgccggccgacatgagcaagccggccgagatcgccggcatgatcgcgctcggc
gagtccacgttcggttcggtcgacgtcctcgtcaacaatgccggcatccagttcgtctcg
ccggtcgaggattttccgccggagaagtgggagcagatcatcgcgatcaatctctcttcc
gcgttctacggcatccacgccgccgtccccggcatgaagaagcgcggctggggccgcatc
atcaacaccgcctcggcgcactccctggtcgcctcgccgttcaagtcggcctatgtctcg
gccaagcacggcatcgccggcctgaccaagacggtcgcgctcgagctcgccaccttcaag
atcacctgcaactgcatctcgccgggctatgtctggacgccgctggtcgaaaagcagatc
ccggacacgatgaaggcccgtaacctcaccaaggagcaggtcatccacgacgtgctgctg
gctgcgcagccgaccaaggaattcgtgacggtcgaccaggtcgccgcgcttgcgctgttc
ctgtgcagcgacgaggcggcgcagatcaccggcaccaacctgtcgatcgacggcggctgg
accgcggagtaa

DBGET integrated database retrieval system