KEGG   Bradyrhizobium sp. ORS 278: BRADO1089Help
Entry
BRADO1089         CDS       T00516                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bra00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bra00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bra00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bra00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1157391..1158272
Genome map
AA seq 293 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDKPLIQYVFDEAKEAGIEHFVFVTGRNK
TAIEDHFDRMYELDATLAARGKKTEMEILARDQPEAGAVSFTRQQAPLGLGHAVWCARDI
VGDEPFAVVLPDELVLNSPGCLAQMIAAANKLPEKSNVLAVQEVPADQTHQYGICGVGPR
DGKIFEVDGMVEKPAKGTAPSNFSITGRYILQPEIFKILATQERGAGGEIQLTDAMIGLS
KTQKFYGVDFDGERHDCGSKSGFLKANIAFGMARADLRDGLRADMQKYLEAKS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccgcaaagccgtttttccggtcgccggtctcggcacccgcgtccttcccgcc
acgaaggcgatgccgaaggagatgctgacgatcgtcgacaagccgctcatccaatacgtc
ttcgacgaggcgaaggaagccggcatcgagcatttcgtgttcgtcaccgggcgcaacaag
acggcgattgaggatcatttcgaccgcatgtacgaactcgacgcgacgctcgcggcgcgc
ggcaagaagaccgagatggaaatcctggcgcgcgaccagccggaggccggcgccgtcagc
ttcacccgccagcaggcgccgctcggtcttggccacgccgtgtggtgcgcgcgcgacatc
gtcggcgacgagccgttcgcggtggtgctgccggacgaactggtgctgaattctccgggg
tgcctggcgcagatgatcgccgccgccaacaagctgcccgagaagagcaatgtgctcgcc
gtgcaggaagtgccagccgaccagacgcatcaatacggcatctgtggcgtaggcccgcgc
gacggcaagatcttcgaggtcgacggcatggtcgagaagccggccaagggcaccgcgccg
tcgaacttctcgatcaccggccgctacatcctgcagcctgagatcttcaagatcctggcg
acgcaggagcgcggcgccggcggcgagatccagctcaccgatgccatgatcggcctgtcg
aaaacgcagaaattctacggcgtcgatttcgacggcgagcggcatgattgcggctcgaag
tccggcttcctgaaggccaacatcgccttcggcatggcccgcgcggatctgcgggacggc
ctgcgcgccgacatgcagaagtacctcgaagccaagagctag

DBGET integrated database retrieval system