KEGG   Bradyrhizobium sp. ORS 278: BRADO1145Help
Entry
BRADO1145         CDS       T00516                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BRADO1145 (ruvA)
Enzymes [BR:bra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BRADO1145 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1218006..1218623
Genome map
AA seq 205 aa AA seqDB search
MIGKLRGLIDSYAEDFVIIDVGGVGYQVHCSARTLQALPSPGEAATLSIETYVREDQIKL
FGFRSDVEREWFRLLQTVQGVGAKVALAVLGTLPPADLGNAIALRDKAAVARTPGVGPKV
AERIVTELKDKAPAFANVDPGVVRLSGAIEESRAPQPVADAISALINLGYGQPQAAAAIA
AASRAAGDKAETAQLIRLGLKELAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaggggcctgatcgattcctatgccgaggacttcgtgatcatcgac
gtcggcggcgtcggctatcaggtgcactgctcggcgcgcaccctgcaggccttgccgtcg
ccgggtgaagccgccacattgtcgatcgagacctatgtgcgcgaggaccagatcaagctg
ttcggttttcgctcggatgtcgaacgggaatggtttcgtcttttgcagaccgtgcagggc
gtcggcgccaaggtcgctcttgccgtgctcggcacgcttcctccggccgatctcggcaac
gcgatcgcgctgcgcgacaaggctgcggtggcgcgcacgccgggcgtggggcccaaggtg
gccgagcgcatcgtgacggagctgaaggacaaggcgccggcgttcgccaatgtcgatccc
ggcgtcgtcaggctgtccggcgccatcgaggaatcccgcgcgccgcagccggtcgcggat
gcgatctccgcgctcatcaatctcggctacggccagccgcaggccgccgccgccatcgcg
gccgcctcgcgtgccgccggcgacaaggccgagactgcccaactcatccgcctcggcctc
aaggaactggccaagtag

DBGET integrated database retrieval system