KEGG   Bradyrhizobium sp. ORS 278: BRADO1339Help
Entry
BRADO1339         CDS       T00516                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRADO1339
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO1339
   00620 Pyruvate metabolism
    BRADO1339
   00640 Propanoate metabolism
    BRADO1339
  Energy metabolism
   00680 Methane metabolism
    BRADO1339
Enzymes [BR:bra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BRADO1339
Lipid biosynthesis proteins [BR:bra01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BRADO1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1427672..1429279
Genome map
AA seq 535 aa AA seqDB search
MLQETSDYDQLYRDFRWDIPAQFNIAVATCDRHADGTGCLALIVVEEDGAARRVSFDELR
DASCRFANVLKADGLAQGDRVAVFLSQSLELPIVHLAAFRAGLVSVPLFTLFGEDALQFR
LQNSGAKVVVTDTTGFAKLQRIRDRLPELKTIYVTDGEGSGARPFWSTLERASAQFPTVA
TSSNDPAIIIYTSGTTGNPKGALHAHRVLLGHLPNVEMVHGFLPKPGDVMWTPADWAWIG
GLFDALFPAWYHAVPVVGYRARKFVPQAAMQLMADYQVRNVFLPPTALKLMRQADVKHDG
VKLRSILTGGESLGAELLDWVRATFGIDAHEIYGQTECNLVVGNNAKLFPIRPGSMGKAT
PGFEVLIVNEKGEELPRGERGIIGVRQPNPCTMIEYWRNPEATSKKFAGDVLLTGDLGTQ
DQDGYFWYASREDDVITSAGYRIGPAEIEDTLLKHPAVALAAVVGIPDPVRTEAVKAWIV
LRSGFVANDTLSRKIQDFVKVKLAAHEYPRHVEFTDSLPMTATGKVLRRELRARG
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggaaacgtccgactacgaccagctgtatcgcgacttccgctgggacatcccg
gcgcagttcaacatcgccgtcgctacctgcgaccgccacgccgacggcacgggctgcctc
gcgctgatcgtcgtcgaggaggatggcgccgcgcgccgcgtgtcgttcgacgagttgcgt
gacgcctcctgccgcttcgccaatgtgctgaaggccgacggcctggcgcagggcgatcgc
gtcgcggtgttcctgtcgcaatctctcgagctgccgatcgtccatctcgccgccttccgc
gccggcctcgtctcggtgccgctgttcacgctgttcggcgaggacgcgctgcaattccgc
ctgcagaactccggcgccaaggtcgtggtgaccgacacgacgggcttcgccaagctccag
cgcatccgcgaccggttgcccgagctcaagacgatctacgtcaccgacggcgaaggcagc
ggcgcccggccgttctggtcgacgctggagcgcgcctcggctcaattcccgaccgtcgcg
acctcgagcaacgatcccgccatcatcatctacacctccggcacgacaggaaatcccaag
ggcgcgctgcacgcccatcgcgtgctgctcggccatctgccgaatgtcgagatggtgcac
ggcttcctgccgaagcccggcgacgtgatgtggacgccggcggactgggcctggatcggc
gggctgttcgatgcgctgtttccggcctggtatcacgcggtgcccgtggtgggctatcgc
gccaggaagttcgtgccgcaggcggcgatgcagctgatggcggactatcaggtccgcaac
gtattcctgccgccgacagctttgaaattgatgcgtcaggccgacgtcaagcatgatggc
gtcaagctgcgcagcatcctcaccgggggtgagtcccttggcgccgaactgctcgactgg
gtgcgcgcgaccttcggcatcgacgcgcacgagatctatgggcagaccgaatgcaacctc
gtcgtcggcaacaacgcaaagctgtttccgatccggccgggctcgatgggcaaggccacg
ccgggcttcgaggtgctcatcgtcaacgagaagggcgaggagctgccacgcggcgagcgc
ggcatcatcggcgtgcgccagcccaatccctgcaccatgatcgaatattggcgcaatccc
gaggcgacgtcgaagaagttcgcgggcgatgtgctgctgacgggagatctcggcacgcag
gatcaggacggctatttctggtacgcgagccgcgaggacgacgtcatcacctcggccggc
taccgcatcggcccggcggagatcgaggacaccctgctcaagcatcccgccgttgcgctt
gccgccgtcgtcggcattcccgatcccgtacgcaccgaggcggtcaaggcctggatcgtg
ctgcggtccggcttcgttgcgaatgacacgctgtcgcgcaagatccaggacttcgtcaag
gtaaagctcgcggcgcatgaatatccgaggcatgtcgaatttaccgacagcctgccgatg
acggcgaccggcaaggtgctgaggcgcgagttgcgcgcgcggggctag

DBGET integrated database retrieval system