KEGG   Bradyrhizobium sp. ORS 278: BRADO1456Help
Entry
BRADO1456         CDS       T00516                                 

Definition
(GenBank) Cytochrome c
  KO
K08738  cytochrome c
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bra00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BRADO1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Haem_bd
Motif
Other DBs
NCBI-ProteinID: CAL75347
RhizoBase: BRADO1456
UniProt: A4YN71
Position
complement(1560408..1560779)
Genome map
AA seq 123 aa AA seqDB search
MLRRIVLIVAFATIASDARALDGDPAAGKSIFQRICQNCHSPEIGINKVGPSLWNVVGRQ
PAAVPDYAYSESMKNNKTPWTAAALDAYIADPRGDVHGVKMYFKGLADAKERADVVAFLS
TLK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgctccgacgcatcgttctcatcgtcgcatttgcgaccatcgcatcggacgccagagcg
ctcgacggcgacccggccgcgggcaaaagcatcttccagcgcatctgccagaactgccac
tcgcccgagatcggcatcaacaaggtgggtccgagcctttggaacgtcgtcggacggcag
ccggcggctgtgccggactacgcgtactccgaaagcatgaagaacaacaagacgccttgg
acggctgcggcgttggacgcctatatcgccgatccgcgcggcgacgttcacggcgtcaag
atgtacttcaagggactcgctgacgcgaaggaacgcgcggacgtcgttgccttcctatca
acgctgaaatag

DBGET integrated database retrieval system