KEGG   Bradyrhizobium sp. ORS 278: BRADO1456Help
Entry
BRADO1456         CDS       T00516                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BRADO1456
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BRADO1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1560408..1560779)
Genome map
AA seq 123 aa AA seqDB search
MLRRIVLIVAFATIASDARALDGDPAAGKSIFQRICQNCHSPEIGINKVGPSLWNVVGRQ
PAAVPDYAYSESMKNNKTPWTAAALDAYIADPRGDVHGVKMYFKGLADAKERADVVAFLS
TLK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgctccgacgcatcgttctcatcgtcgcatttgcgaccatcgcatcggacgccagagcg
ctcgacggcgacccggccgcgggcaaaagcatcttccagcgcatctgccagaactgccac
tcgcccgagatcggcatcaacaaggtgggtccgagcctttggaacgtcgtcggacggcag
ccggcggctgtgccggactacgcgtactccgaaagcatgaagaacaacaagacgccttgg
acggctgcggcgttggacgcctatatcgccgatccgcgcggcgacgttcacggcgtcaag
atgtacttcaagggactcgctgacgcgaaggaacgcgcggacgtcgttgccttcctatca
acgctgaaatag

DBGET integrated database retrieval system