KEGG   Bradyrhizobium sp. ORS 278: BRADO1471Help
Entry
BRADO1471         CDS       T00516                                 

Gene name
cysQ
Definition
CysQ protein (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bra00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1578039..1578875)
Genome map
AA seq 278 aa AA seqDB search
MATGPTPGTIGVEAAAALMTPLTELVVEAAHAILAVNRRAMAVTDKSDGSPVTEADLAAD
RVIADGLARLAPDIPALSEERVSACAAPFKGSFFLIDPLDGTKEFLAGRGEFTVNLALVR
DASPLLGIVCAPAIGLIWRGLVGRGAERLSFSEAGLSAPAPIRTRPMPKPGEPWVAAVSR
SHGDARSEAFIAARPGADRLALGSAVKFGRLAEGLADIYPRLGPTSEWDVAAGHAVVVAA
GGTVTSEAGVALRYGERSDSFIVPSFIAWGDPRAVTAV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggggccgaccccgggaaccatcggcgtcgaggccgcggccgcgctgatgacg
ccgttgaccgagctcgtcgtcgaggctgcgcacgcgatcctcgcggtgaaccggcgcgcg
atggccgtcaccgacaagtccgacggctcgccggtcaccgaagccgatctcgccgccgat
cgcgtcattgccgatggattggcgcggctggcgccggacattccggccttatccgaggaa
cgggtgagcgcctgcgcggcgccgttcaagggcagcttcttcctgatcgacccgctcgac
ggcaccaaggagttcttggccggccgcggcgagttcacggtcaatctggcgctggtccgc
gacgcgagccctctgctcggcatcgtctgcgcgcccgcgatcgggctgatctggcgcggc
ctggtcggccgcggcgccgagcggctgtcattctccgaagccggcttgagcgcgcctgcc
ccgatccgcacccggccgatgcccaagccgggcgagccatgggtcgccgcggtcagccgc
tcacatggcgatgcccgcagcgaagccttcatcgcggcccgccccggcgcggatcggctg
gcgctcggctcggcggtgaagttcggccggctggcagaggggctggcggacatctatccg
cggctcggcccgacctcggaatgggacgtggcggccggccatgccgtggtggtcgcagcc
ggcggcaccgtgaccagcgaggccggtgttgccttgcgctatggcgagcgcagcgacagc
ttcattgtgccgagcttcatcgcctggggcgatccccgcgcggtgactgctgtttga

DBGET integrated database retrieval system