KEGG   Bradyrhizobium sp. ORS 278: BRADO1520Help
Entry
BRADO1520         CDS       T00516                                 

Definition
multicopper oxidase copper resistance protein A (EC:1.10.3.3)
Orthology
K00423  
L-ascorbate oxidase [EC:1.10.3.3]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:bra00053]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1624664..1625965)
Genome map
AA seq 433 aa AA seqDB search
MLSRRTLLGSAALAGASAVSGRVQAAAIPEAPTMDKAVMQPPLHPSAGADYQPVVTLNGW
SLPFRMNGDWKEFHLVAEPVTREFAPGMTAHLWGYNGQSPGPTLEAVEGDKVRIFVTNKL
PEYTTVHWHGVILPCGMDGVGGLTQPHIKPGKTFVYEFEMKHAGTFMYHPHADEMVQMAM
GMMGMIVVHPRGSVPPPVDRDYVFVMSSYRVEPGSYLPKVNEMIDFNMWTWNARVFPGID
PMPARLGDRVRIRIGNLTMTNHPIHLHGHKFKVTGTDGGWLPEAAQFPETTTDVPVGAVR
VLDFTADNPGDWAFHCHKSHHTMNAMGHDMRNLIGVSRKELAAAVGKLAPEGMVMGHTGM
AMGSMEMPAPDNTLPMMTGTGQFGPIEMGGMFTTLKVRDGLARDDYRDPGPYQFPQGSVA
YEVAGAPQPVRRG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcacgccgaaccctgctcggctccgcggcgctggccggcgcctccgccgtatcc
ggccgcgtccaggccgccgcgattcccgaagcgcccaccatggacaaggccgtgatgcag
ccgccgctgcatccatccgccggtgcggactatcagccggtggtgacgctcaacggctgg
tcgctgccgtttcgcatgaacggcgactggaaggaattccatctcgtcgccgagccggtc
acgcgcgagttcgcgccgggcatgacggcgcatctgtggggctacaacggccagtcgccg
ggcccgaccctcgaggcggtcgagggcgacaaggtccggatcttcgtgaccaacaagctc
ccggaatacaccaccgtgcactggcacggcgtgatcctgccctgcggcatggacggtgtc
ggcggactgacgcagccgcacatcaagcccggcaagaccttcgtctacgagttcgagatg
aagcacgccggcaccttcatgtatcacccgcacgccgacgagatggtgcagatggcgatg
ggcatgatgggcatgatcgtcgtgcatccgcgcggttccgtgccgccgccggtcgaccgc
gactacgtgttcgtgatgtcgagctaccgggtcgagcccggcagctatctgccgaaggtc
aacgagatgatcgacttcaacatgtggacctggaacgcccgcgtcttccccggcatcgat
ccgatgccggcgcggctcggcgaccgcgtgcgcatccgcatcggcaatctcaccatgacc
aaccatccgatccatctgcacggccacaagttcaaggtgaccggcaccgatggcggctgg
ctgcccgaggctgcgcaatttcccgagacgaccaccgacgtgccggtcggcgcggtccgc
gtgctcgacttcaccgccgacaatcccggcgactgggcattccactgccacaaatcgcat
cacacgatgaacgcgatgggccacgacatgcgcaacctgatcggcgtgtcgcgcaaggag
ctcgccgccgccgtcggcaagctcgcgcccgagggcatggtgatgggacacaccggcatg
gcgatgggtagcatggagatgcccgcgcccgacaataccttgccgatgatgaccggcacc
ggccagttcggcccgatcgagatgggcggcatgttcacgacgttgaaggtgcgcgatgga
ctcgcgcgcgacgactatcgcgatcccggcccgtatcagttcccgcaaggctccgtcgcc
tacgaggtcgccggcgcaccgcagccggtgcggcgcggctga

DBGET integrated database retrieval system