KEGG   Bradyrhizobium sp. ORS 278: BRADO1575Help
Entry
BRADO1575         CDS       T00516                                 

Definition
carbohydrate kinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRADO1575
   01230 Biosynthesis of amino acids
    BRADO1575
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO1575
   00030 Pentose phosphate pathway
    BRADO1575
   00051 Fructose and mannose metabolism
    BRADO1575
   00052 Galactose metabolism
    BRADO1575
  Energy metabolism
   00680 Methane metabolism
    BRADO1575
Enzymes [BR:bra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BRADO1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1688145..1689083)
Genome map
AA seq 312 aa AA seqDB search
MSDIVTITPNPAVDVSTTVESIVPVAKLRGTTQRRDPGGGGINVARVITRLGGDVTALYP
VGGPTGLLLKQLVESEGVASRTWATHDDTREDFFVQERATGQPYRFILPGPTLSEAESQA
GLALLSGLDPFPRYVIGSGSLPRGVPTDYYARIAKIARARGAQFILDTSGPALAAAVEGG
VDLIKPSLREMHELVGGELPDAVAWEAAARTLVATGKARIVALTMGHLGALVVTSERVLR
AQPLTLVPVNAVGAGDSFLGALIAKLAAGEPMDEAFRFAVAAGAAALLRTGTALCDPADI
NRLLAHVRLQTA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcgtcacgatcacgccgaacccggccgtcgatgtctcgacgaccgtcgag
agcatcgtgcccgtggccaagctgcgcggcaccacgcagcggcgcgatcccggcggcggc
ggcatcaatgtcgcacgcgtcatcacgcggctcggcggcgacgtgacggcgctctatcca
gtgggcggcccaaccggcctcctgctgaagcaattggtcgagagcgaaggcgtggccagc
cgcacctgggccacgcatgacgacacgcgcgaggatttctttgtccaggagcgcgccacc
ggccagccttatcgcttcatcctgccgggaccgacgctcagcgaagccgagtcgcaggcc
gggctcgcgctgctcagcggactcgatccgttcccgcgttacgtcatcggcagcggcagc
ctgccgcgcggcgtgccgacggactactacgcgcgcatcgcgaagatcgcgcgcgcacgc
ggcgcgcagttcatcctcgatacatccggacctgcgctggccgcggcggtcgaaggcggc
gtcgacctgatcaagccgtcgctgcgcgagatgcacgaactcgtcggcggcgagctgcct
gatgcggtggcgtgggaagccgccgcgcgaacgctggttgcgacaggcaaggccaggatc
gtcgcgctgaccatgggccatctcggcgcgctcgtggtgacatccgagcgcgtgctgcgt
gcgcagccgctgacgctggtgccggtcaacgctgtcggcgccggcgacagttttctcggc
gccttgatcgccaagctcgccgccggtgagcccatggacgaggcgttccgcttcgccgtc
gccgccggcgcggccgcactgctgcgcacgggcacggcgctgtgcgacccggctgatatc
aaccgtctgctggctcacgtgcggctgcagacggcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system