KEGG   Bradyrhizobium sp. ORS 278: BRADO1575Help
Entry
BRADO1575         CDS       T00516                                 

Definition
carbohydrate kinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bra01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bra01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bra00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bra00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bra00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bra00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bra00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1688145..1689083)
Genome map
AA seq 312 aa AA seqDB search
MSDIVTITPNPAVDVSTTVESIVPVAKLRGTTQRRDPGGGGINVARVITRLGGDVTALYP
VGGPTGLLLKQLVESEGVASRTWATHDDTREDFFVQERATGQPYRFILPGPTLSEAESQA
GLALLSGLDPFPRYVIGSGSLPRGVPTDYYARIAKIARARGAQFILDTSGPALAAAVEGG
VDLIKPSLREMHELVGGELPDAVAWEAAARTLVATGKARIVALTMGHLGALVVTSERVLR
AQPLTLVPVNAVGAGDSFLGALIAKLAAGEPMDEAFRFAVAAGAAALLRTGTALCDPADI
NRLLAHVRLQTA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcgtcacgatcacgccgaacccggccgtcgatgtctcgacgaccgtcgag
agcatcgtgcccgtggccaagctgcgcggcaccacgcagcggcgcgatcccggcggcggc
ggcatcaatgtcgcacgcgtcatcacgcggctcggcggcgacgtgacggcgctctatcca
gtgggcggcccaaccggcctcctgctgaagcaattggtcgagagcgaaggcgtggccagc
cgcacctgggccacgcatgacgacacgcgcgaggatttctttgtccaggagcgcgccacc
ggccagccttatcgcttcatcctgccgggaccgacgctcagcgaagccgagtcgcaggcc
gggctcgcgctgctcagcggactcgatccgttcccgcgttacgtcatcggcagcggcagc
ctgccgcgcggcgtgccgacggactactacgcgcgcatcgcgaagatcgcgcgcgcacgc
ggcgcgcagttcatcctcgatacatccggacctgcgctggccgcggcggtcgaaggcggc
gtcgacctgatcaagccgtcgctgcgcgagatgcacgaactcgtcggcggcgagctgcct
gatgcggtggcgtgggaagccgccgcgcgaacgctggttgcgacaggcaaggccaggatc
gtcgcgctgaccatgggccatctcggcgcgctcgtggtgacatccgagcgcgtgctgcgt
gcgcagccgctgacgctggtgccggtcaacgctgtcggcgccggcgacagttttctcggc
gccttgatcgccaagctcgccgccggtgagcccatggacgaggcgttccgcttcgccgtc
gccgccggcgcggccgcactgctgcgcacgggcacggcgctgtgcgacccggctgatatc
aaccgtctgctggctcacgtgcggctgcagacggcgtga

DBGET integrated database retrieval system