KEGG   Bradyrhizobium sp. ORS 278: BRADO1576Help
Entry
BRADO1576         CDS       T00516                                 

Gene name
glk
Definition
(GenBank) Glucokinase (Glucose kinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00010  Glycolysis / Gluconeogenesis
bra00052  Galactose metabolism
bra00500  Starch and sucrose metabolism
bra00520  Amino sugar and nucleotide sugar metabolism
bra00521  Streptomycin biosynthesis
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01200  Carbon metabolism
Module
bra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO1576 (glk)
   00052 Galactose metabolism
    BRADO1576 (glk)
   00500 Starch and sucrose metabolism
    BRADO1576 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BRADO1576 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BRADO1576 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BRADO1576 (glk)
Enzymes [BR:bra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BRADO1576 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CAL75456
RhizoBase: BRADO1576
UniProt: A4YNI0
Position
complement(1689087..1690067)
Genome map
AA seq 326 aa AA seqDB search
MSERVLLGDIGGTNARFALLDDGTIGQVAHLKVADFPTIADAITDFLARHAAGGPPASAV
LDIAGPIERNRGMLTNSTWVIDGAELAAHFNLRSAKLLNDFEAVGWSLPALHPDDLFALG
GHAAVEGAPMLVIGPGTGFGAACYLPNDGRPTVAVTEAGHATLPATTMREATVLAKMRER
FGHVSIERALSGMGLENVYQAIAAVDGVDVPKRDAAAITHAALDGSCATSRATLDMFCAW
LGAVAGNLALTFCARGGVYIAGGIPPRFPDYFAKSAFRRQFESKGRYDSYLRSIPVHLVT
KPDISFLGLKSFHESSVPSSGGSPAT
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcgcgttcttctgggggacatcggcggcaccaatgcgcggttcgcgctgctc
gacgacggaacgatcggccaggtcgcccatctgaaggtcgcggatttcccgaccatcgcc
gatgccatcaccgacttcctggcgcgacacgctgccggcggaccgccggcctccgccgtg
ctggacatcgcaggtcccatcgagcgcaaccgcggcatgctgaccaactctacctgggtc
atcgacggcgccgagctggccgcgcacttcaatctgcgctcggcgaagctgttgaacgat
ttcgaagcggtcggctggtcgctgccggcgctgcatcccgacgatctgtttgcgctcggc
ggccatgcggcggtcgagggcgcgccgatgctggtgatcggcccgggcaccggattcggc
gcggcctgctatctcccgaatgatggccgtccgaccgtcgcggtcaccgaggcgggccac
gcgaccctgccggcgaccacgatgcgcgaggccaccgtgctcgccaagatgcgcgagcgc
ttcggccatgtctcgatcgagcgcgcgctgtccggcatgggcctcgagaacgtctatcag
gcgatcgcagcggtcgacggcgtcgacgtgcccaagcgtgacgcagcggcgatcacccac
gccgcgctcgatggcagctgcgccaccagccgcgccacgctcgacatgttctgcgcctgg
ctcggcgccgtcgccggcaatctggcgctgaccttctgcgcccgcggcggcgtctacatc
gccggcggcatcccgccgcgcttcccggactacttcgcgaagtcggcgttccgccggcag
ttcgagagcaagggacgctacgacagctatctgcggtccattcccgtacatcttgtcacc
aagcccgacatcagctttctcggcctcaagtccttccacgagtccagcgtcccctcgagc
ggcggatctcccgcaacctga

DBGET integrated database retrieval system