KEGG   Bradyrhizobium sp. ORS 278: BRADO1606Help
Entry
BRADO1606         CDS       T00516                                 

Gene name
bchI
Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BRADO1606 (bchI)
Enzymes [BR:bra01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BRADO1606 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1719052..1720152
Genome map
AA seq 366 aa AA seqDB search
MWSHAANAAETCREQGTLMGIAFPFSAIVGQDEMKLALMIAAVDPKVGGVLAFGDRGAGK
STAVRALAALLPPMSAVVGCPYQCDPADAAAQCAECRARSKPAGKGKTPAPLKAHQVPVP
VIDLPLGATEDRVVGALDLERALAHGEKSFEPGLLARANRGFLYIDEVNLLEDHLVDLLL
DVAASGENVVERDGLSIRHPARLVLVGTGNPEEGELRPQLLDRFGLSVEVKTPSDLPTRI
EVIKRRDAFETDNAAFVAHWEKEEAKQRKRILAAREHIGSVKVADRELENAARLCMALGT
DGLRGELTLMRAARAAAALDGAKAVDDGHLKTVAPMALRHRLRRNPLDDSGSSVRVERAL
NELFAS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgtggtctcatgccgccaacgcggcggagacctgccgcgaacaggggacgctcatggga
attgcctttccgttctcggccattgtcggccaggacgagatgaagctggcgctgatgatc
gccgccgtcgatcccaaggtcggcggcgtgctggcctttggcgatcgtggcgccggcaaa
tccaccgccgtgcgcgcgctcgccgccctgctgccgccgatgagcgccgtggtcggctgc
ccctatcaatgcgacccggccgatgcggccgcacaatgtgccgaatgccgcgcgcgttcg
aagccggccggcaagggcaagacgccggcgccgctcaaggcccatcaggtgccggtgccc
gtcatcgacctgccgctcggcgccactgaggaccgcgttgtcggtgcgctcgatctggag
cgcgcgctggcgcatggcgaaaagtcgttcgagcccggactgctggcgcgcgccaaccga
ggctttctctatatcgacgaggtcaacctgctggaggatcatctcgtcgacctgctgctc
gacgtcgccgcatcgggcgagaacgtggtcgagcgcgacggcctcagcatccgccatccc
gcgcgcctcgtgctcgtcggcaccggcaatccggaggaaggcgagctgcggccgcaacta
ctcgaccgtttcgggctgtcggtcgaggtgaagacgcccagcgatctgccgacgcgcatc
gaggtgatcaagcggcgcgatgcgttcgagactgacaatgccgccttcgtcgcgcattgg
gagaaggaggaggccaagcagcgcaagcgcatccttgcggcgcgcgagcatatcggctcg
gtcaaggtcgccgatcgcgagcttgagaacgcggcgcggctgtgcatggcgctcggcacc
gacggtctgcgcggtgaactcaccctgatgcgcgcggcacgcgccgcggcggcgctcgac
ggcgccaaggcggtcgatgacggccatctgaagacggtggcgccgatggcacttcggcac
agactgcggcgcaatccgctcgacgattccggctcgtcagtgcgggtcgagcgcgcgctc
aatgagctgttcgcgtcgtga

DBGET integrated database retrieval system