KEGG   Bradyrhizobium sp. ORS 278: BRADO1607Help
Entry
BRADO1607         CDS       T00516                                 

Gene name
bchD
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BRADO1607 (bchD)
Enzymes [BR:bra01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BRADO1607 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1720149..1721888
Genome map
AA seq 579 aa AA seqDB search
MTDGAAIWADAVIAAALAAIDPSSSVLLRAGAGPVREQWLEMLRELMPASVPLRKLPPSI
SDDRLLGGLDLAATLQARHPVIQRGLLAEANGGMLIAVMAERMAPSAVAHLSAALDTGAV
SIERDGLSLRAPARVGLIALDEGIDDERVSPALADRLACHVDLSTVARADLGESLFKSSD
IAAARALLPQVRLSEEAIAALTTTAVALGIDSLRAPLLACRIARIAAALDGETDVAEQHI
ACAARLVLAPRATRLPANEDDADSPEPPEPQNEQAENAEDDRANGGPLEDRVLEAAQAAI
PFDLLKRLQDERAMRARASSAGRQGQAQKAPKRGRPIGARRGEWRAGARLNVLETLRAAA
PWQPLRRRAKPAGKSGRIIVHKDDIRITRFKQRSGTTTIFVVDASGSSALQRLAEVKGAV
ELLLAECYIRRDEVALIAFRGRTAELLLPPTRSLTRAKRSLAGLPGGGGTPLSAAIFAAT
ELALAVKAKGQAPTIVLMTDGRANVARDGGGRSEAEAEALVAARQLALTGIPVVLVDSSP
RPQDKAAQLAGAMQARYVALPHADATRLSQAVMAQAGRG
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacggcgccgcgatctgggccgatgcagtcatcgcggccgcgctggccgcgatc
gatccatcctcgtcggtactgctgcgagccggggcaggtccggtgcgcgagcaatggctt
gagatgctacgcgagctgatgccggcgtcggtaccgctgcgcaagctgccgccgtcgatc
tccgacgaccgcctgctcggggggctcgatctcgccgcgaccttgcaggcgagacatccg
gtgattcagcgcgggctgctcgccgaagccaatggtggcatgctgatcgccgtgatggcc
gagcgcatggcgccgtccgctgttgctcatctctctgctgcgctcgacaccggagctgtc
agtatcgagagggatggcctctcgctccgcgcgccagctcgcgttggcctgattgcgctc
gacgagggcatcgatgacgagcgcgtgtctcctgcattggccgatcgcttggcctgtcat
gtcgatctcagcacggtcgcgcgcgctgatctcggtgagagcctgttcaaatcctctgac
attgcagcggcgcgtgcgctactgccgcaggttcgcctgtcagaggaggcgatcgccgcg
ttgaccacgacggctgtcgcgctcggcatcgactcgctgcgcgcccccttgctggcctgc
cgcatcgcgcgcatcgcagcggcgctcgacggcgagactgacgttgccgagcagcacatt
gcttgcgccgcgcggctggtgctggcgccgcgggccacgcggctgcctgccaatgaggac
gacgccgacagccccgagccgccggagccgcagaacgaacaggccgagaacgccgaggac
gaccgtgccaatggcggtccgctcgaggatcgcgtgctcgaagcagcgcaggccgccatt
cccttcgatttgttgaagcgcctgcaggacgagcgcgcgatgcgagcgcgggcgagcagc
gcaggacggcagggccaggcgcagaaggcgccgaagcgcggacggccgatcggcgcgcgt
cggggcgaatggcgcgccggggcgcggctcaacgtgctcgagacgttacgtgccgcggcg
ccgtggcagccgttgcggcggcgggcgaagcccgccggcaagagcgggcgcatcatcgtc
cacaaggacgatatccgcatcacccgcttcaagcagcgatccggcaccacgacgatcttc
gtcgtcgatgcgtccggctcgtcggcgctgcagcggctggcggaggtgaagggcgcggtc
gagctgctgctcgccgagtgctacatccgccgcgacgaggtggcgctgatcgcgtttcgc
ggccggacagccgagctgctgctgccgccgacccgctcgctgacgcgcgccaagcgcagc
ctcgccggcctgcccggcggcggcggcacgccgctgtcggccgcgatcttcgccgcgacc
gagctggcgctcgcggtgaaggccaagggccaggcgccgacgatcgtgctgatgaccgac
ggccgcgccaatgtcgcgcgcgatggcggcgggcgcagcgaggctgaggcggaggcgctg
gtggccgccaggcagcttgccttgaccggcatccctgtcgtgctggtcgactcctcgcca
cgcccgcaagacaaggcggcgcaactcgccggggcgatgcaggcccgctatgtcgctctg
cctcacgccgacgccacacgcctgtcgcaggctgtcatggcccaggccggtcgcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system