KEGG   Bradyrhizobium sp. ORS 278: BRADO1630Help
Entry
BRADO1630         CDS       T00516                                 

Gene name
cycA
Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BRADO1630 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BRADO1630 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1746273..1746707
Genome map
AA seq 144 aa AA seqDB search
MLKSGLVAAVVIATSAGAAFALDGGDAAKGEQVFKQCMTCHRIGPDAKNAVGPVLTGVVG
RPTGTAPGFAYSELNKHAGEAGLVWTDDNIFEYLADPNAFLKKYLTEKGKADQATGSTKM
VFKLANEQQRKDVVAYLKTFSEKK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaatcgggtttggttgcggcggtcgtgattgcaacgtcggcaggcgccgcattc
gcgctggacggcggcgacgctgcgaaaggcgagcaggtcttcaagcaatgcatgacctgc
caccgcatcggacccgatgcgaagaatgctgtgggtccggttctgaccggtgtggtcggc
cgcccgacggggaccgctccgggatttgcctattccgagctcaacaagcacgccggcgag
gccgggctggtctggaccgatgacaacatcttcgaatacctcgccgaccccaacgccttc
ctgaagaaatatctcaccgagaagggcaaggcggaccaagccaccggctcgaccaagatg
gtgttcaagctcgccaacgagcagcagcgcaaggacgtcgtcgcttatcttaagaccttc
tcggagaagaagtga

DBGET integrated database retrieval system