KEGG   Bradyrhizobium sp. ORS 278: BRADO1641Help
Entry
BRADO1641         CDS       T00516                                 

Gene name
bchH
Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bra00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1756752..1760342
Genome map
AA seq 1196 aa AA seqDB search
MPKRISVADVTPIRVVIVTMDSHLASAALRARAALQAELPGLDLKVHAADEWGCNPNALE
HCLADIATGDIVVATMLFMEDHIQPVLPALQARRDQCDAMIGCLSAGEVVRLTRLGKLTM
SGSATGVLGLLKRLRGSNRSGNSSGQGQMKMLQRMPRLLRYIPGTAQDLRAYFLTLQYWL
AGSEQNFANMVRFLVGRYADGPRAALRGKTNAAEPVTYPDVGLYHPRLPQRIIERADQLP
ALAKPAGRVGVILMRSYLLAANTAHYDGVIAALEARGLAVVPVFACGLDSRPAIERYFQK
DGVATVDAVISLTGFSLVGGPAYNDARAAEEVMAGLDVPLIAAHPLEFQTVEQWHDDARG
LTPVEATMMVAIPELDGAVGPTVFGGRSAMADAGRDMASLPERAAQLSARVARLVELRRS
ARAERKIAAVLFNFPPNGGSAGTAAYLSVFESLHNVMTSLRAAGYTIDVPATVDELRARV
LKGNAERFGTAANVAVRIPVDQHVRRERHLAEIEKQWGPAPGRHQTDGASLMVLGEQFGN
LFVGLQPAFGYEGDPMRLLFERSFAPTHAFAAFYRWLREEYRAHAVLHFGTHGALEFMPG
KQAGLSAECWPERLIGDLPNFYIYASNNPSEGALAKRRGGATLISYLTPSITSAGLYKGL
AELKSSLDAWRNLSPDATEQVRADSAALIQAQAATVDLAAAEPAWGDERNARIAALSANV
LELEYSLIPHGLHVVGSPPPAEQRAELLDLAGITDAAKRVELDRLLATDSETPAILHALD
GGYIRPVPGGDLLRNTDVLPTGRNLHGFDPFRIPSAFALKDAERQVARLLDRHAGEGHKL
PETIALVLWGTDNLKTEGGPIAQALWLIGAAPRHDSYGRLCGARLIPLEQLGRPRIDVVI
TLSGIFRDLMPLQTKLLAEAALLAASADESAEFNYVRKHALAFQAAHGGEIADAALRVFG
NAEGAYGANVNQLIDCGAWTDEDELADVYTRRKGFAYGTDGRPVRRDALLGHVLAGVDAA
YQNVDSVELGVTTIDHYFDTLGGISRAVKRAKGEAAPVYIGDQTRGEGTVRTLSEQVALE
TRTRTLNPKWYEALLAHGYEGVRQIESHVTNTVGWSATTGQVAPWVYQQITTTFVLDPAM
RERLASLNPAASAKIANRLIEAHERNYWTPDADMLDVLRKAGEELEDRLEGVGVAA
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagcgcatttcggtcgctgacgtcacacccatccgggtggtgatcgtgacgatg
gacagccatctcgcctcggctgccctgcgtgcccgcgcggccctgcaggccgaactgccc
ggcctcgatctcaaggtgcacgcggccgacgaatggggctgtaatccgaacgcgctcgag
cattgcctcgccgatatcgcgaccggcgacatcgtggtcgcaacgatgctgttcatggag
gaccacatccagcctgtgctgcctgcgttgcaggcgcgccgtgatcagtgcgatgcgatg
atcggctgcctgtcggccggcgaggtggtgcgactgacgcggctcggcaagctgacaatg
tcgggctcggccaccggcgtgctcggcctgttgaagcggctgcgcggcagcaaccgctcc
ggcaattcgagcggccagggccagatgaagatgctgcagcggatgccgcgtctgctgcgc
tacatccccggcaccgcgcaggacctgcgcgcctatttcctgactctgcaatactggctc
gccggctccgagcagaattttgcgaacatggtgcgctttctcgtcggccgctacgccgac
ggcccgcgggccgcgctgcgcggcaagaccaacgccgccgagccggtgacctatccggat
gtcggcctctatcatccgcggctgccgcagcgcatcattgagcgcgccgatcagttgccg
gcgctggcgaagccagccggccgcgtcggcgtcatcctgatgcgctcctatctgctcgcc
gccaacaccgcgcactacgacggcgtgatcgcggcgctggaggcgcgcggcctcgcggtc
gttcccgtgttcgcctgcggcctcgactcgcgtccggcgatcgaacgctatttccagaag
gacggcgtcgccaccgtggatgcggtgatctcgctcaccggcttctcgctggtcggcggt
cccgcctacaacgacgcccgcgcggcggaagaggtgatggccgggctggacgtgcccctg
atcgctgcgcatcccctcgaattccagactgtcgagcagtggcatgacgatgcgcgcggc
ctgacgccggtcgaagccaccatgatggtcgcgatccccgagctcgacggcgctgtcggt
ccgaccgtgttcggcggccgctcggcgatggccgatgccggccgtgacatggcctcgctg
ccggagcgcgccgcccagctttctgcgcgagttgcccgcctggtcgaactgcgccgctcg
gcgcgggcggagcgcaagatcgcggcggtgctgttcaacttcccgccgaatggcggcagc
gccggcaccgcggcctatctctcggtgtttgagtcgctgcacaatgtgatgacatcgctg
cgcgccgccggctacacgatcgacgtgcccgccacggtcgacgagttgcgcgcccgcgtg
ctcaagggcaatgccgagcgcttcggcaccgccgccaatgtcgcggtgcgcattccggtc
gatcagcatgtccgccgcgagcgccatctcgccgagatcgagaagcagtggggtccggcg
cccggccgtcaccagaccgacggcgccagcctgatggtgctgggcgagcagttcggcaat
ctgttcgtcggcctgcagcccgccttcggctacgagggcgatccgatgcggctcttgttc
gagcgcagcttcgcgccgacgcacgccttcgccgcgttctatcgctggctgcgcgaggag
tatcgcgcccacgccgtgctgcatttcggcacccatggcgcgctcgaattcatgccgggc
aagcaggccgggctctccgccgaatgctggccggagcggctgatcggcgacctgccgaac
ttctacatctacgcctcgaataacccgtccgagggcgcgctcgccaagcgccgcggcggc
gcgaccctgatcagctatctcacgccttcgatcaccagcgccggtctctacaagggcctt
gccgagctgaaatcctcgctcgacgcctggcgcaatctgtcgccggacgcgacggagcag
gtgagggcggatagcgccgcgctgatccaggcgcaggcggcgaccgtcgatctcgcagcc
gccgagccggcctggggcgatgagcgcaacgccaggatcgccgcgctctcggccaacgtg
ctggagctggaatattcgctgatcccgcacggcctgcacgttgtcggttcgccgccgccg
gcggagcagcgggccgagctgctcgacctcgccggcatcaccgacgccgccaagcgcgtc
gagctcgaccggctgctcgccaccgacagtgagacgcctgcgatcctgcatgcgctcgat
ggcggctacatccggccggtgccgggcggcgatctgctgcgcaacaccgacgtgctgccg
accggccgcaacctgcatggcttcgatccgttccgcattcccagcgccttcgcgctcaag
gatgccgagcgccaggtggcgcggctgctcgatcgccatgccggcgagggccacaagctg
ccggagacgatcgcgctggtgctgtggggcaccgacaatctcaagaccgagggcggcccg
atcgcgcaggcgctgtggctgatcggcgccgcgccgcgccacgacagctatggccggctc
tgcggcgccaggctgatcccgctggaacagctcggacgcccgcgcatcgacgtcgtgatc
acgctgtccggcatcttccgcgatctgatgccactgcagaccaagctgctcgccgaggct
gcgctgcttgccgcttccgcagatgaatcggctgaattcaactacgtgcgcaagcacgcg
ctggcgttccaagccgcccatggcggcgagatcgccgatgcggcgctgcgcgtgttcggc
aatgccgagggtgcctatggcgccaacgtcaaccagctgatcgattgcggcgcctggacc
gacgaggacgagctcgccgacgtctacacgcggcgcaagggctttgcctatggcaccgac
ggccgcccggtccgccgcgacgcgctgctcggccatgtgctcgccggcgtcgacgccgcc
tatcagaacgtcgactcggtcgagctcggcgtcaccaccatcgatcattatttcgacacg
ctcggcggcatcagccgcgcggtgaagcgcgccaagggcgaggcggcgccggtctatatc
ggcgaccagacccgcggcgaaggcaccgtgcggacgctgtccgagcaggtcgcgctggag
acgcgcacccgcacgctcaatccgaaatggtacgaggcgctgctcgcgcacggctacgaa
ggcgtgcgccagatcgagtcgcacgtcaccaacaccgtcggctggtcggcgaccacgggg
caggtggcgccctgggtctatcagcagatcaccacgaccttcgtgctcgaccccgcgatg
cgcgagcgccttgcctcgctcaatccggccgcgtccgcgaagatcgccaaccgtctgatc
gaggcgcatgagcgcaactactggaccccggatgctgacatgctcgacgtgctgcgcaag
gccggggaagagctcgaagatcgcctcgaaggcgtgggagtagccgcatga

DBGET integrated database retrieval system