KEGG   Bradyrhizobium sp. ORS 278: BRADO1815Help
Entry
BRADO1815         CDS       T00516                                 

Definition
galactose mutarotase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO1815
   00052 Galactose metabolism
    BRADO1815
Enzymes [BR:bra01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BRADO1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1940511..1941590
Genome map
AA seq 359 aa AA seqDB search
MAEADISRDVFGSLPDGREVERVTLRGAGGFEARIITFGAALQTLLVPDAQGTVDDVVLG
HDDLLSYVKLRKFFGATVGRYANRIAKARFMLDGEEIRLDANNGPHALHGGPDGFDRKLW
QIVAIDDGPQPSVTMLYVSADGEANYPGRLDVRVTYRLTGPTELAISFSARTTRTTVVNL
TNHSFFNLDGLAAGTDILDHRLTLAADHYLAIDETAIPLEGPPQSVIGTPFDFREAHPVG
ARIRADDAQIKCGRGYDHNFCLRAGEGVRLAARVESPRSGRVMELLTDQPGLQIYSGNYI
DATVSGKGRVYRQSDAICLEPQVWPDSPNRPDFPSARLSPEDVYRHETVYRFSTAGAAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcagatatctccagggatgtgtttggcagcctgcccgacggccgagaggtc
gagcgcgtcaccttgcggggcgccggcggcttcgaggcgcggatcatcacgttcggtgcg
gcgctgcagaccctcctggtgccggacgcgcaaggtaccgtcgacgacgtcgtgctcggc
cacgacgatctgctgagctacgtcaagctgcggaagttcttcggcgcgacggtcggacgc
tacgccaaccggatcgccaaggcgcgctttatgctcgacggcgaggagatccgcctcgac
gccaacaatggtccccacgccttgcatggcggccccgatggcttcgaccgcaagctctgg
cagatcgtcgccatcgacgacggtccacagccctccgtcacgatgctttacgtcagcgcc
gacggcgaggccaactatcccgggcggctcgacgtccgcgtcacctatcggctgaccggt
ccgaccgaactggccatcagcttcagcgcccggacgacccgcacgacggtcgtcaacctg
accaatcacagcttcttcaatctcgacggcctggccgcgggcaccgacattctcgaccat
cgtctgacgctcgcggccgaccactatctcgcgatcgacgagaccgcgatcccgctggag
ggaccaccgcaatccgtgatcggcacgccgttcgactttcgcgaggcccatccggtcggc
gcgcgaatccgtgccgatgacgcgcagatcaagtgcggccgcggctacgaccacaatttc
tgtctgcgagccggcgagggcgtccgcctggcggcgcgggtggagtcgccacgctctgga
cgggtcatggagctgctcacggatcagcccggcctgcagatctattccggcaactacatc
gacgcgaccgtcagcggcaagggacgcgtctatcgccagtccgacgcgatctgtctggag
ccgcaggtgtggccggacagcccgaaccggccggacttcccgagcgcgcggctttcgccg
gaggacgtctatcggcacgagacggtctatcgcttctcgaccgcgggagcggccgcatga

DBGET integrated database retrieval system