KEGG   Bradyrhizobium sp. ORS 278: BRADO1827Help
Entry
BRADO1827         CDS       T00516                                 

Gene name
cheB
Definition
chemotaxis response regulator protein CheB-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bra02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bra02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1954334..1955392
Genome map
AA seq 352 aa AA seqDB search
MSAIRVLIVDDSAFVRQVLTDILSSDPAIQVVGAAPNPIVARDMIKSLNPDVLTLDIEMP
RMDGLAFLDKIMALRPMPVLMISSLTQKGADTAIRALEMGAFDCVAKPVVGLVEGLPAMR
NEIVSKVKAASVAKIRTRSGEQVRPIQRPGVSYNTSEKIIAIGASTGGVEALQELLMAFP
SDAPAAVITQHMPAMFTASFAARLNQLCAVTVKQAVSGERVLPGHAYIAPGGFHMELGRN
GANYVCRVHDEPAVSGHRPSVDVLFRSVAHAAGPNAIGVILTGMGRDGAVGLLEMRTAGA
PTIGQDEASCVVYGMPKAARECGAVEIELPLGKIADQVLKRCESLAARGVRV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccattcgcgttctgatcgtcgacgactcggccttcgtgcgccaggtcctgacc
gacattttgtcgagcgacccggcgatccaggtcgtcggcgccgcgccgaatcccatcgtc
gcgcgcgacatgatcaagagtctcaaccccgacgtgctcacgctcgacatcgagatgccg
cgcatggatggtcttgcctttctcgacaagatcatggcgctgcggccgatgccggtcctg
atgatctcgtcgctcacccagaagggcgcggacactgccatccgcgccctggagatgggc
gcgttcgattgcgtggcgaagccggtagtcgggctggttgagggcctgcctgcgatgcgc
aacgagatcgtcagcaaggtcaaggcggcatcggtcgcgaagatccggacgcgctccggg
gagcaggtccgtccgatccagcggccgggcgtctcctacaatacgtcggagaagatcatt
gcgatcggtgcctccaccggcggcgtcgaggcgctgcaggagctgctgatggcgtttccc
tccgacgcaccggcagccgtcatcacccagcacatgccggcgatgttcaccgcctccttt
gccgcccggctgaaccagctgtgcgcggtcacggtcaaacaggcggtcagcggtgagcgc
gtgctgcccggtcacgcctatatcgcgccgggcggcttccacatggagctcggacgcaat
ggtgcgaattatgtctgccgcgtccatgacgagccggccgtctccggtcatcggccgtca
gtcgacgttctcttcaggtccgtcgcgcatgccgcggggccgaatgcgatcggcgtcatc
ctgaccggcatgggacgcgacggtgcggtcggcctcctggagatgcgcacggcgggagcg
ccgacgatcggccaggacgaggcgagctgcgtcgtctacggcatgcccaaggcggcgcgc
gaatgcggcgccgtcgagatcgagctgccgctcggcaagatcgccgatcaggtcctgaag
cggtgtgagtcgctcgctgcgcgcggggtcagggtttaa

DBGET integrated database retrieval system