KEGG   Bradyrhizobium sp. ORS 278: BRADO2106Help
Entry
BRADO2106         CDS       T00516                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BRADO2106 (pncA)
Enzymes [BR:bra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BRADO2106 (pncA)
    3.5.1.-  
     BRADO2106 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2238829..2239464
Genome map
AA seq 211 aa AA seqDB search
MWIGMQIKTHEDVLLVIDVQNDFCPGGQLAVAEGDAVVPVINRLSGLFDHVVLTQDWHPA
GHSSFASSHPGKAPFESVTMPYGPQTLWPDHCIQGTKGAAFHDDLATDKAQLIIRKGFRA
AIDSYSAFFENDKTTPTGLAGYLRERGLKRVFLVGLATDFCVHYSAVDARRLGFSAVVID
NACRGIDLGGSMAAAKAQGAEAGVERIAELV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgtggataggaatgcagatcaagacccatgaggatgtgctgctcgtcatcgacgtgcag
aacgatttttgtccgggcgggcagcttgccgtcgccgagggcgacgccgtcgtgcccgtc
atcaaccggctgagcgggctgttcgatcacgtcgtgctgacccaggactggcatccggca
ggccacagctcgttcgcctccagccaccccggtaaggcgccgttcgagagcgtgaccatg
ccctatgggccgcagaccctgtggccggatcattgcatccagggcacaaagggggcggcg
tttcatgacgatctcgcgacagacaaggcgcagctgatcatccgcaaggggtttcgcgcg
gcgatcgattcctattccgcgttcttcgagaacgacaagaccacgcccacaggcctcgcc
ggctatttgcgcgagcgcggcctgaagcgggtgttcctggtcgggctcgcgaccgatttc
tgcgtgcactactcggcggtcgacgcgcggcggctcggcttttcggctgttgtcatcgac
aacgcgtgccgcggcatcgatctcggcggctcgatggcagcggccaaggcgcaaggcgcg
gaggccggcgtggagcggatcgcggagctcgtgtga

DBGET integrated database retrieval system