KEGG   Bradyrhizobium sp. ORS 278: BRADO2290Help
Entry
BRADO2290         CDS       T00516                                 

Definition
chemotaxis protein methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bra02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bra02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2440278..2443454
Genome map
AA seq 1058 aa AA seqDB search
MQRDMATGGVSQSGDKKRRPLVIGVGASTSHTESLARFLSRAALDQDLAIVLVLRHREGL
DEEWLRQVLQPLENVRLRALEDGAEIEGQVIYLCPPDMIATLHDNRAVLRQSPQAPGERA
TIDSLLVSLAEERAEQAIGVILAGTGGDGTLGVAALKDHGGLALAERPVGEEEEPQDSSR
AAAIADFVLAAEDIPDHIQVYARHLRRLEDRQGFDEVLAAAATSLDRIADILRTKTGNDF
HGYKQNTFLRRVQRRMQVAQIGDVSAYVDFLRNDKDEVQHLFNDLLIGVTEFFRDRREFE
VLEQDVIPQIFAGRQRGHPIRVWVLGCATGEEAYSIAILLREHAARLDAPPPLQIFATDI
DGKALAAARVGRYRTDIEANISPERLARWFVREGDTYCVVKELREMCIFSQHNVIKDAPF
SKLDLVSCRNLLIYLNAELQNRVIPLFHFSLLPGRFLFLGNSENVTRHPKLFAPVDRRAR
IFRKLDGGSRLPPEFPISTAAGRATVDMPAIRPFNADVGLERKAQRIAERYAPAYVITDS
NFQILHFSGRTGRFIEPTAGVATLDLLGLVHRDLRLELRTALGHARDFNQIVHADQVMLG
VNGHTIGVDITVEPVEDSDNGHRNFVVLFKDGPLRPPATALASGSSALVRSEHVERLESE
LRATRERLQATIEELESTNEELKSSNEEYQSLNEELQSANEELETSREELQSVNEELTTV
NGELAHRVQELTRATSDLKNFLESTQIATVFVDNDLRVMNFTPAITQVLHLVETDVGRPI
AHIKARIPIKELYEDIRRVLRTLASAERELIAPDSGTRFIVRMLPYRSVDNFIAGVVMTF
IDVTAITRAEERQRLLLAELQHRVRNTLGVVRSIARRSAQTSSTVEEYAAHLDGRLGALA
RTQAAVTRDPQAGVDLEYLLADELMAYKAREGEQVRISGPSMRLQPKAAETLSLAIHELA
TNAVKYGALSQPTGRIDISWHIDESVTPKELVFEWRERGGPEVKPSKRKGFGSEILERTL
AFELKGRTQLSFNPAGMQFQIILPLSRSFVQGPATGQR
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcgggacatggccacaggcggcgtctctcaatcgggcgacaagaagcggcggccg
ctggtgatcggcgtcggcgcctccaccagccataccgaaagccttgcccggttcctgtcc
agagctgcgctcgatcaggaccttgccattgtgctcgtgctgcggcatcgcgagggtttg
gacgaagaatggctgcgccaggtgctgcagccgctggagaacgtccgcctccgggctctc
gaggacggcgccgagatcgaagggcaggtgatctatctttgtccgcccgacatgatcgcg
accttgcacgacaaccgcgcggtcctgcgtcaaagcccgcaggcgccgggcgagcgtgcc
accatcgatagcctcctggtgtcgcttgccgaggagcgcgcggagcaggcgatcggcgtt
attctggctggcaccggtggtgacggcacgctcggcgtcgcggcgttgaaggatcatggc
gggctcgccctcgccgagcgcccggtcggcgaggaagaggaaccgcaggacagcagccgg
gccgccgcgatcgccgatttcgtgctggcggccgaggacatcccggatcacatccaggtc
tacgcccgtcaccttcgcaggctggaggaccgccagggcttcgacgaggtgctcgccgca
gccgccacctcgctcgaccgcattgccgacatcctgcgcaccaagaccggcaacgacttc
cacggctacaagcagaatacctttctgcgccgcgtccaacgccgcatgcaggtggcgcag
atcggcgatgtttccgcctatgtcgatttcctgcgcaacgacaaggacgaggtccaacac
ctgttcaacgacctcctgatcggcgtgaccgagttctttcgcgacaggcgggagttcgag
gtgctggagcaggatgtcattccgcagatctttgccggcaggcagcgcggacatccgatc
cgcgtctgggtcctgggctgcgccaccggcgaggaggcctattcgatcgccattctgctg
cgtgagcacgccgccaggctcgacgcgcctcccccgctgcagatcttcgcgaccgatatc
gacggaaaggcgctggcggccgcgcgggtcggccgctaccggaccgacatcgaagccaac
atctcgccggaacggctggcgcgctggttcgtgcgcgagggtgacacctattgcgtggtc
aaggagctgcgcgagatgtgcatcttctcccagcacaacgtcatcaaggacgctccgttt
tcgaagctcgacctggtgtcgtgccgcaatctgctgatctatctgaacgcggagttgcag
aaccgcgtgatcccgctgttccacttctcgctgctgccgggccgctttctgttcctggga
aattcggagaacgtgacgcggcatccgaagctgtttgcgccggtcgaccgtcgcgcgcgc
atcttccgcaagctcgacggcgggtcgcggctcccgccggaattcccgatcagcacggcc
gcgggacgcgcgacggtcgacatgccggcgatccgccccttcaatgccgatgtcgggctg
gagcgcaaggcacagcgcatcgccgagcgttatgcgccggcctatgtcatcaccgacagc
aacttccagatcctgcacttctccggccgcaccggccgcttcatcgagccgaccgccggc
gtcgcgaccttggatctgctcggcctcgttcatcgcgacctgcggctcgaattgcggacg
gcgctcggtcatgcccgcgacttcaatcagatcgtgcatgccgaccaggtgatgcttggc
gtcaacggccatacgatcggcgtcgacatcacggtcgagccagtcgaggatagcgacaac
ggtcaccgcaactttgtcgtgctgttcaaggacggcccgctgcgcccgcccgccacggcg
ctggccagcggcagcagcgcgctggtgcgcagcgagcatgtcgagcggctcgagagcgag
ctgcgggcgacgcgcgagcggctccaggcgacgatcgaggagctggagagcaccaacgag
gagctgaaatcctccaatgaggaatatcaatcgctgaacgaggagctgcaatccgccaat
gaggagctggagacctcgcgcgaggagctgcaatcggtcaacgaggagctgacgacggtc
aatggcgagctggcccatcgtgtccaggagttgacacgcgcgaccagcgatctgaagaac
tttctcgagagcacgcagatcgcgaccgtattcgtggataacgatctgcgggtgatgaat
ttcactcccgccatcacccaggtgctgcatctcgtcgagaccgatgtcggccggccgatc
gcgcatatcaaagcaaggatcccgatcaaggagttgtacgaggacatccgccgggtcctc
cgcacgctcgccagcgccgagcgcgagctgatcgcgcccgatagtggcacccggttcatc
gtgcggatgctgccctatcgaagtgtggataatttcatcgccggcgtggtgatgaccttc
atcgacgttaccgcgatcacccgcgccgaggagcgccagcggctgctgctcgccgaactg
cagcatcgcgtgcgcaacacgctcggcgtggtccgctcgatcgcgcggcgctcggcccag
accagttcgaccgtcgaagagtatgccgcccacctcgatggccggctcggcgcgctggcg
cgcacccaggcggcggtgacgcgcgacccccaagcgggggtggatctcgaatatctcctg
gccgacgaactgatggcctacaaggcgcgcgagggcgagcaggtgcgcatctccggaccg
tcgatgcggctgcagcccaaggccgcggagaccttgtcgctggcgatccacgagctggcg
accaatgcggtgaaatacggcgcgctgagccagcccaccgggcgcatcgatatcagctgg
catatcgatgagagcgtgactcccaaggaattggtgttcgaatggcgagagagaggaggg
cctgaggtgaagccgtcgaaacgaaagggatttggcagcgaaattctggagcgcaccctg
gcgtttgagctgaagggcaggacgcaattgtcgttcaatccggccggcatgcaatttcaa
atcatccttccgctcagccgcagtttcgtccagggccctgcgaccggccagcgatga

DBGET integrated database retrieval system