KEGG   Bradyrhizobium sp. ORS 278: BRADO2457Help
Entry
BRADO2457         CDS       T00516                                 

Definition
NAD-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BRADO2457
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO2457
  Lipid metabolism
   00071 Fatty acid degradation
    BRADO2457
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRADO2457
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BRADO2457
   00626 Naphthalene degradation
    BRADO2457
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRADO2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2617472..2618563
Genome map
AA seq 363 aa AA seqDB search
MPDHGSESMKSFKVTDFNAPLTEVDEPTPQPFGKQVLIKVKAAGVCHSDLHIWEGGYDLG
HGRKPLSLKDRGVSLPRTMGHESAGEIVAFGPEVTEAEKGGLKVGDVALVYPWIGCGKCA
TCLAGDENMCLKPASLGVYCDGGYADHMTVPHPRHLIDLKGLDPVTTAPYACSGVTTYSA
LKKVETDFDTPIVIFGAGGLGLMALSLLKAMGGKGAIVVDIDARKREAALAAGALAAVDG
KAPDALEQLNKAAGEPIRAVIDLVGNAATAQLGFDCLTKGGKLVIVGLFGGGAPWALPLI
PIKAVTIQGSYVGNLRETKELLDLVRAKNIAPIPVTPMPLARANDALHELQKGQLVGRAV
LTP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgccggaccacgggagtgaaagcatgaagagcttcaaggtcaccgatttcaacgcgccg
ctgaccgaggtcgacgagccgacgccgcagccgtttggcaagcaggtgctgatcaaggtg
aaggcggccggcgtctgccatagcgacctgcacatctgggaaggtggctatgaccttggc
cacggccgcaagccgctgtccttgaaggatcgcggcgtctcgctgccgcggaccatggga
cacgagagcgccggtgagatcgtggcgttcgggcccgaggtcaccgaagccgagaaaggg
ggcttgaaggttggcgacgtcgcgctggtctatccctggatcggctgcggcaaatgtgcc
acttgcctcgccggcgacgagaacatgtgtctgaaaccggcctcgctcggcgtctattgc
gacggcggttatgccgatcacatgacggtgccgcatccgcgccacctgatcgatctcaag
ggtctcgatcccgtgacgaccgcgccttatgcctgctcgggcgtgacgacctacagcgcg
cttaaaaaggtcgagacggattttgatacgccgatcgtcatcttcggcgccggcggtctc
ggcctgatggcgctgtccttgctcaaggcgatgggcggcaagggcgccatcgtcgtcgac
atcgacgcccgcaagcgcgaggccgcgctcgcggcaggcgcgctggccgccgtcgacggc
aaggcgccggatgcgctggagcagttgaacaaggcggcgggcgagccgatccgggcggtg
atcgacctggtcggcaatgccgccacggcgcagctcggcttcgactgcctgaccaagggc
ggcaagctcgtcatcgtcggcctgttcggcggcggcgcgccctgggcgctgccgctcatt
ccgatcaaggcggtgacgatccagggcagctatgtcggcaatctgcgcgagaccaaggaa
ctgctcgacctcgtccgcgccaagaacatcgcgccgatcccggtgaccccgatgccgctc
gcgagggccaatgatgccctgcacgagctgcaaaagggccagctggtcggccgcgcggtg
ctgacgccgtag

DBGET integrated database retrieval system