KEGG   Bradyrhizobium sp. ORS 278: BRADO2613Help
Entry
BRADO2613         CDS       T00516                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bra00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2801417..2802037)
Genome map
AA seq 206 aa AA seqDB search
MRNTAKKLPFVCDPVTVTQDDVEDAIRTILTWIGEDPSREGLSETPARVARAYKSYFAGY
DQNPEDYLRKTFEETAGYDEMVLLRNIPFQSHCEHHMAPIIGRAWVGYVPRNRVVGISKL
ARVVEAYAARLQIQERMTAEIANIIDEVLQPEGVAVVIKAAHHCISSRGVKKHGVDLTTS
RMLGCFRSDPMSRQEFLAMVNSDLKD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaacacagccaagaaactccccttcgtttgcgatcccgtcacggtcacccaggac
gacgtcgaggacgccatccgcaccatcctgacctggatcggcgaggatccctcgcgcgag
ggcctctcggagacgccggcccgcgtcgcccgcgcctacaagagctacttcgccggctac
gaccagaacccggaggactatctccgcaagaccttcgaggagaccgccggctacgacgag
atggtgctgctgcggaacatccccttccagagccactgcgagcaccacatggcgccgatc
atcggccgcgcttgggtcggctacgtgccgcgcaaccgtgtcgttggcatttccaagctc
gcccgggtcgtcgaggcctacgcggcccggctgcagatccaggagcgcatgacagccgag
atcgccaacatcatcgacgaggtgctccagccggaaggcgttgccgtcgtcatcaaggcc
gcccaccactgcatcagctcacgcggggtcaagaagcatggcgtcgacctgaccaccagc
cgcatgctcggctgcttccgctctgacccgatgagccggcaggagtttctcgcgatggtt
aactccgacctgaaggattga

DBGET integrated database retrieval system