KEGG   Bradyrhizobium sp. ORS 278: BRADO2685Help
Entry
BRADO2685         CDS       T00516                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bra00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2885547..2886404)
Genome map
AA seq 285 aa AA seqDB search
MSAILPHAASDLTASHPLLRPWLARPYPAVMGILNVTPDSFSDGGRFNAPDRALDQAQAM
IAAGADIIDIGAESTRPYKGAEPVTADEELARLEPVLPAIVALGVPVSIDSMKSEVVDHA
LNHGAVIANDVWGLQRDPAMADVVATHRAPVVVMHNRAAVDAQIDIIDDMLRFFTRSLDI
AAKAGIPDGNIVLDPGIGFGKTAEQSMRALARLDAFARFGLPLLVGASRKRFISSVVTSE
PRERLGGSIAAHLIAAQRGAAIIRAHDVAETVQAVRVAASIEALG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccatcttgccgcacgccgcctcggatctcaccgcgagccacccgctgctgcgg
ccgtggctggcgcgtccgtatccggccgtcatgggcatcctgaacgtcacgccggattcg
ttctccgacggcggccgtttcaacgcgccggaccgcgcgctcgaccaggcccaggcgatg
atcgcggccggcgcggacatcatcgacatcggagccgagtcgacccgtccctacaagggc
gcggagcctgtcacggcagatgaagagttggcgcggctcgaacccgtcctgcccgcgatc
gttgcgctcggtgtgcctgtgtcgatcgacagtatgaaatctgaggttgtcgatcatgcg
ctcaaccatggcgctgtgatcgccaacgatgtctggggcctacagcgcgatccggcaatg
gccgatgtggtcgccacgcatcgcgctccggtcgtggtgatgcacaaccgcgccgcggtc
gatgcgcagatcgacatcattgacgacatgctccgcttcttcacgcgctcgctcgacatc
gccgccaaggccggcattcccgatggcaacatcgtgctcgatcccggcatcggtttcggc
aagaccgccgagcagagcatgcgggcgctggcgcggctcgatgcgttcgcgcgcttcggc
ctgccgcttttggtcggcgcctcgcgcaagcgtttcatcagctcggtcgtgacgtcggag
ccgcgagagcggctcggcggctcgatcgcggcgcatctgatcgcggcgcagcgcggggct
gcgatcatccgggcgcatgacgtcgccgagacggtccaggccgtgcgcgtggccgcaagc
atcgaggcactgggatga

DBGET integrated database retrieval system