KEGG   Bradyrhizobium sp. ORS 278: BRADO2724Help
Entry
BRADO2724         CDS       T00516                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BRADO2724
Enzymes [BR:bra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BRADO2724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2925814..2927265)
Genome map
AA seq 483 aa AA seqDB search
MISRRSRALRPEVFSGFSRVELRCNSRTLLATLLITDDDALVGPDEIGLSEPALRRFAEP
AGMLATVSPATPPESLEAVRAKIRGETLSDEAIAAVIEDLAHYRYSDMEIAAFLIGSASF
MTSGELLALTHAMANAGTQLTWPEPVVVDKHCIGGIPGNRTSMVVVPIVAAHGLTIPKTS
SRAITSPAGTADTMEVLARVNVGAEEMKSIVAACNGCVIWGGHVNLSPADDILISVERPL
SLDTREQMVASILSKKLAAGSTHLLLDLPVGPTAKLTSGAEAMRLRKLFEFVGDRFGLKV
EVITTDGRQPIGHGIGPVLEARDVMAVLGNEPQAPADLREKSLRLAAHLLEYDPKLRGGA
GYSRARELLDSGAALKQMQKIIDAQGPSAGRSELGDLAFDVGAASDGVVSAIDCLRLNRL
ARTAGAPVNKGAGIRLYKKIGDRVDQGEPLYRVFTCDPSEHDLAAAAASANNGYVLDGPN
GPH
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcgcgacgctcgcgggccttgcggcccgaggtcttcagcggcttttcccgggtc
gagctgcgctgcaattcgcgcaccctgctcgccaccctgctgatcaccgacgacgacgcc
ctggtggggcctgacgagatcgggttgtccgagcccgcgttgcggcgcttcgccgagccg
gccggcatgctggcgacggtatcgccggccaccccgcccgagagcctggaggcggtgcgc
gccaagatccgaggcgaaactctcagcgacgaggccatcgcggctgtgatcgaggacctc
gctcactaccgctactcggacatggaaatcgccgcattcctgatcggctcggccagcttc
atgacgtccggcgagttgctggcgctgacccacgcgatggccaatgcgggcacccaactg
acatggcccgagcccgtcgtcgtcgacaagcattgcatcggcggcatccccggcaaccgt
acctccatggtggttgtgccgatcgtcgccgcccatggcctgaccatcccgaagacgtcc
tcgcgcgcgatcacctcgccggccggcaccgccgacacgatggaggtgctggcccgcgtc
aacgtcggcgccgaggagatgaagtcgatcgtcgcggcctgcaacggctgcgtgatctgg
ggcggccacgtcaatctgtcgccggccgatgacatcctgatctccgtcgagcgcccgctc
agcctggacacccgagagcagatggtcgcctccatcctgtcgaagaagctcgccgccggc
tcgacgcatctgctgctcgacctgccggtcggcccgacggcgaagctcaccagcggtgcg
gaggccatgcggctgcgcaagctgttcgaattcgtcggcgaccgcttcggcctgaaggtc
gaggtgatcacgaccgacggccggcagccgatcggccacggcatcgggccggtgctcgag
gcgcgcgacgtgatggcggtgctcggcaacgagccgcaggcaccggccgacctgcgcgag
aaatcgctgcgcctcgcggcgcatctgctcgaatatgatccgaaactgcgcgggggcgcc
ggctattcacgcgcgcgcgagttgctcgacagcggcgcggcgctgaagcagatgcagaag
atcatcgacgcacaggggccgtccgcgggccgcagcgagctcggcgatctcgctttcgac
gtcggggctgccagcgacggcgtcgtctcggcgatcgactgcctgcggctcaaccgcctg
gcacgcaccgccggcgcgccggtcaataagggcgcgggcatccggctgtacaagaagatc
ggcgaccgtgtcgaccagggcgagccgctgtaccgcgtgttcacctgcgatccgtccgag
catgatctggcggcagcggccgcgagcgccaacaatggctatgtcctcgatggcccgaac
ggccctcactaa

DBGET integrated database retrieval system