KEGG   Bradyrhizobium sp. ORS 278: BRADO2777Help
Entry
BRADO2777         CDS       T00516                                 

Gene name
purS
Definition
phosphoribosylformylglycinamidine synthase subunit PurS (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bra00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2986750..2986992
Genome map
AA seq 80 aa AA seqDB search
MKARVTVTLKTGILDPQGKAIEGALKSLGVDGVASVRQGKVFDIELAGADKASAEAALKA
AADKLLANTVIENYRVELLG
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgcgtgtcacggtgacactgaaaaccggcatcctcgatccccagggcaaggcg
atcgagggcgccctcaaatcgctcggcgtcgatggcgtcgccagcgtgcgccagggcaag
gtgttcgacatcgagctcgccggcgccgacaaggcgagcgcggaggcggccctgaaggcc
gccgccgacaagctgctcgccaacacggtgatcgagaattaccgggtggagctgctgggg
tag

DBGET integrated database retrieval system