KEGG   Bradyrhizobium sp. ORS 278: BRADO2777Help
Entry
BRADO2777         CDS       T00516                                 

Gene name
purS
Definition
phosphoribosylformylglycinamidine synthase subunit PurS (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BRADO2777 (purS)
Enzymes [BR:bra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     BRADO2777 (purS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2986750..2986992
Genome map
AA seq 80 aa AA seqDB search
MKARVTVTLKTGILDPQGKAIEGALKSLGVDGVASVRQGKVFDIELAGADKASAEAALKA
AADKLLANTVIENYRVELLG
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgcgtgtcacggtgacactgaaaaccggcatcctcgatccccagggcaaggcg
atcgagggcgccctcaaatcgctcggcgtcgatggcgtcgccagcgtgcgccagggcaag
gtgttcgacatcgagctcgccggcgccgacaaggcgagcgcggaggcggccctgaaggcc
gccgccgacaagctgctcgccaacacggtgatcgagaattaccgggtggagctgctgggg
tag

DBGET integrated database retrieval system