KEGG   Bradyrhizobium sp. ORS 278: BRADO2866Help
Entry
BRADO2866         CDS       T00516                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BRADO2866 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO2866 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BRADO2866 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRADO2866 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BRADO2866 (adhA)
   00626 Naphthalene degradation
    BRADO2866 (adhA)
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRADO2866 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3065832..3066857
Genome map
AA seq 341 aa AA seqDB search
MQTMKAAVVKAFGKPLVIEDVPVPVPGPGELLVKLKACGVCHTDLHAASGDWPVKPTPPF
IPGHEAAGVVAALGAGVTDFKVGDAVGVAWLHDACLRCEYCETGWETLCEHQHNTGYSVN
GGFAEYVIAAAAFAARLPANVDFARVAPILCAGVTTYKGLKETDTRPGEWVVISGVGGLG
HVAIQYAKAMGLKAIGLDIAEDKLKLALEAGAAHAVNALDNDAVDRVLQITGGGAQGVLV
TAVSTPAFAQALKMVRRKGTVSLVGLPPGEFPTPIFDVVLKRITVRGSIVGTRRDLDEAI
AFAAEGKVKAEVTTAPLSEINTIFDRMKAGKIDGRVVLDFT
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatgaaagccgccgtcgtcaaagcctttggcaagccgctcgtcatcgaggac
gtgcctgttccggtgcctggtccgggcgagcttctcgtcaagctgaaggcctgcggcgtc
tgtcatactgatctccacgcggcttcgggcgattggccggtcaagccgacgccgcccttc
atcccaggccacgaagcggccggcgtggtcgccgcgctcggtgctggcgtgaccgacttc
aaggtcggcgatgccgtcggtgtggcttggctgcacgacgcgtgcttgcgttgcgaatat
tgcgagaccggctgggaaacgctgtgcgagcaccagcacaatacgggctacagcgtgaat
ggcggcttcgccgagtacgtcatcgccgcggccgcattcgcggcgcgcctgccggccaac
gtcgacttcgccagagtcgcgccgatcctgtgcgccggcgtcacgacctacaagggcttg
aaggagacggacacccgtccgggcgagtgggtggtgatctctggcgtgggcggcctcggt
cacgtcgcgatccaatacgccaaggcgatggggctgaaggcgatcggtctcgacatcgcc
gaggacaagctcaagctggcgctggaggcgggtgccgcgcacgccgtcaacgcgctcgac
aacgacgccgtggaccgcgttctccagatcacggggggaggggcgcagggcgtgctcgtg
acggcggtctcgaccccggcgttcgcgcaggccttgaagatggtcagacgcaagggcacc
gtcagcctggtcggcctgcctcccggcgaattcccgacgccgatcttcgacgtcgtgctc
aagcgcatcaccgtgcgcggctcgatcgttggcacgcggcgtgacctcgacgaggccatc
gcctttgccgccgagggcaaggtgaaggcggaggtcaccacggcgccgctgtcggagatc
aacaccatcttcgaccgcatgaaggccggcaagatcgacggccgcgtggtgctggatttc
acctga

DBGET integrated database retrieval system