KEGG   Bradyrhizobium sp. ORS 278: BRADO2867Help
Entry
BRADO2867         CDS       T00516                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BRADO2867
  Lipid metabolism
   00561 Glycerolipid metabolism
    BRADO2867
   00600 Sphingolipid metabolism
    BRADO2867
Enzymes [BR:bra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BRADO2867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3066958..3068238
Genome map
AA seq 426 aa AA seqDB search
MTAVTKIVFLGASSASFGLSVFRDLFSTQDLAGSTLVLVGRDTTRLARSERLARLLNDRS
GAGLRIEATTDWRAALDGAGFVIHSTAIDRNRLWKLDFEVPRKYGIRHTLGENGGPGALF
FTLRTLPVVFDFVREMEQRCPNALFINFSNPESRIILALGLHSRLAHVGLCHGIFIARSQ
VASILGLAEERVEVWGAGLNHFQCLLQIRDRETGADLYPLLRERERSHDPKVAPLTRTLL
HDFGVWLGCGDGHVGEYLAYGWEAGERGYDFAWDEAERARLIRQIDDVLSGTAEMPAWWR
SPSGERAVTVIGAVLHDRKQSIESGVVLNRGVIPNLPAEAAVEVPVVADRCGIHPISLGP
LPNAVAKLMAIQVQVQQLSVQAAMTASRDVALQALLVDPVVNSATAARQILDELWEVNRP
YIRPCA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgtcaccaagatcgtcttcctcggtgcgagcagcgcatcgtttgggctcagc
gtgtttcgggacttgttctcgacccaggatctcgcgggatcgacgctggttctggtcggt
cgggataccacgcggctcgcgcggtcggaacggctggcccggctgctgaacgaccgctcc
ggtgcgggcctcaggatcgaggcgacgacggattggcgcgccgcgctcgacggcgccggt
ttcgtgattcattccaccgcgatcgaccgcaatcggctgtggaagctcgacttcgaagtg
ccgcgcaaatacggtatccgccatacgctcggtgagaatggcgggccgggcgcgttgttc
tttacgctccgcaccttgcctgttgtgttcgacttcgttcgggaaatggagcagcgctgc
ccgaacgcgctgttcatcaacttctccaatcccgagagccgcatcatcctggcactcggt
cttcacagccggctcgcccatgtcggcctgtgccacggcatcttcatcgcgcggagccaa
gtggcgtcgatcctcgggctggcggaggagcgcgtcgaggtatggggcgccggcctcaat
catttccagtgcctgctgcagatccgtgaccgtgaaaccggagccgacctctatccgctg
ctgcgcgaacgggagcgcagtcacgaccccaaggtcgcgccgctgacccgcacgctgctg
catgatttcggcgtctggctcggctgcggcgatggccatgtcggcgagtatctcgcttat
ggctgggaggcgggcgagcgcggctatgattttgcctgggatgaggcggaacgcgccagg
ctgatccgccagatcgacgacgtgctgtcgggaacggccgagatgccggcttggtggcgg
tccccgtcgggcgaacgcgcggtgaccgtgatcggtgcggtgctgcacgatcgcaagcag
tccatcgagtccggcgtcgtgctcaaccgcggcgtcatccccaatctcccggccgaggcg
gccgtcgaagtgcctgtcgttgcggatcgctgcggcattcatccgatctccttgggtccg
ctgccgaacgccgtcgccaagctgatggcgatccaggttcaggtgcagcagctctccgtg
caggcggcgatgaccgcctccagggacgtcgcgctgcaggcgctgctggtcgacccggtc
gtgaactcggccacggcggctcgccagatcctcgacgaactctgggaggtgaaccggccc
tacattcggccatgcgcctga

DBGET integrated database retrieval system