KEGG   Bradyrhizobium sp. ORS 278: BRADO3025Help
Entry
BRADO3025         CDS       T00516                                 

Definition
(GenBank) putative 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00500  Starch and sucrose metabolism
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
Module
bra_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRADO3025
Enzymes [BR:bra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BRADO3025
Exosome [BR:bra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRADO3025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C CBM_48 DUF3459
Motif
Other DBs
NCBI-ProteinID: CAL76830
RhizoBase: BRADO3025
UniProt: A4YSF4
Position
3223598..3225559
Genome map
AA seq 653 aa AA seqDB search
MDMLLEPVTLPPFPEGIRISLRQMHLLQAPMGGTLVTGGATFRVFAPHAKAIYVSGPFND
WAQDANCRLAPIGNGHWAIFVPGLKDGDAYMYFVEGEGNAGYKRDPHARLLTVEPPFPQA
HSVLRNPQAFPWHDTDFTPPPSNELVIYQLHVGVFDMKAGNPDGCFFDVIERVPHLKRLG
INAIELLPVQEFPTMFSMGYNGTDLFSPETEYGEHEAGHLAAYFARTNEILTAAGAAAYA
DIGVVRHCDDQLRALIDVCHVHGIAVLFDVVYNHAGGGFDENSIWFFDRQAYGDPNRSLY
FTDQGWAGGQVFAYWNADVRQYLVDNAIMLYREYHADGLRFDEVSVMDRFGGWATCQQLT
EALRAEKPDAIQIAEYWPVNPWIVKDIAAGGAGFDATWSDGLRLAVRGAIASAAGGAGAQ
VAMQPIAAALADLGLGERWRAVNSIENHDIVYAGREPRISRLADPVDSRCWYARSRCRVA
TGLLLTAPGIPMLFMGQELFEDRPWSDTPSPDTTIQWALLDGEDKITADAIRFTSELIAV
RRTHPALTAEGCAIVHVHDGNRVLAFHRWDGKGDDVMVIVSLSETPWRDYAIGFPAGGTW
HEVFNSDVYDNWVNPGVVGNNGAVTANGPALHGQPSSAMVTIPANGVLVFART
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtggatatgctgctggaacctgttacgctgccgccattccccgaaggcatccgaatttcc
ttgaggcagatgcatcttctccaggctcccatgggcggcaccctggtgaccggcggcgcc
accttccgcgtgttcgcaccgcatgccaaggcgatctacgtctccggcccgttcaacgat
tgggcgcaggacgcgaactgccgtctcgcgccgatcggcaacggccattgggcgatcttc
gtgcccggcttgaaggacggcgacgcctacatgtatttcgtcgagggcgagggcaatgcg
ggctacaagcgtgatccgcatgcgcggctgctcaccgtcgagccgccgttcccgcaggcg
cattcggtgctgcgcaacccgcaagcctttccctggcacgacacggatttcacgccgccg
cccagcaacgagctggtgatctatcagcttcatgtcggcgtcttcgacatgaaagccggc
aatcccgatggctgcttcttcgacgtgatcgagcgcgtgccgcatctgaagaggctcggt
atcaatgccatcgagttgctgcctgtgcaggaattcccgaccatgttcagcatgggctac
aacggcaccgacctgttcagcccggagaccgagtatggcgagcacgaagcggggcatctc
gccgcctatttcgcccggaccaacgagattctcacggccgcgggcgcagcagcttacgcc
gatatcggcgtcgtcaggcattgcgacgaccagctgcgcgcgctgatcgacgtctgccat
gtccatggcatcgccgttctgttcgacgtcgtctacaaccacgctggcggcgggttcgat
gagaacagcatctggttcttcgaccgtcaggcctatggcgatcccaaccgcagcctgtat
ttcaccgatcagggctgggccggcggccaggtgtttgcctattggaatgccgacgtgcgg
cagtacctcgtcgacaacgctatcatgctctatcgcgagtatcacgccgacgggttgcgc
ttcgacgaggtcagcgtgatggaccgcttcggcggctgggcgacctgccagcagctcacc
gaggcgctgcgcgcggagaaaccggacgcgatccagatcgcggagtactggccggtcaat
ccgtggatcgtgaaggacatcgccgccggcggcgccggattcgacgcgacgtggagcgat
ggactgcggctcgcggtgcggggcgcgattgccagcgcagcaggcggagcaggggctcaa
gtcgccatgcagccgatcgccgccgcgctcgccgatctcggcctgggcgagcgctggcgc
gccgtcaactcgatcgagaaccacgacatcgtctatgccggccgcgagccgcgcatctcg
cgtctggccgatcccgtcgacagccgctgctggtacgcgcgcagccgctgccgtgtcgcc
accggcctgttgctgaccgcgccgggcatcccgatgctgttcatgggccaggagctgttc
gaggaccgtccctggagcgacacgccgagcccggacaccaccatccaatgggcgctgctc
gacggcgaggacaagatcacggcggatgcgatccgcttcacgtcggagctgatcgctgtc
cgccgcacccatccggcgctgaccgccgagggctgcgccatcgtccacgtccacgacggc
aatcgcgtgctcgccttccaccgctgggacggaaagggcgacgacgtcatggtgatcgtc
agtttgagcgagacgccgtggcgcgactacgcgatcggcttcccggcaggcggcacttgg
cacgaggtgttcaacagcgacgtctacgacaattgggtcaatccgggcgtggtcggcaac
aacggcgcggtgaccgcgaacggccccgcgctgcacggccagccgagctcggccatggtg
acgatccctgccaacggcgtgctggtgtttgccaggacatga

DBGET integrated database retrieval system