KEGG   Bradyrhizobium sp. ORS 278: BRADO3130Help
Entry
BRADO3130         CDS       T00516                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bra00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bra00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bra00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3325604..3327466)
Genome map
AA seq 620 aa AA seqDB search
MTTDTPRPHRNPQHWASAAMPPLQRFLSACHADFWPDHDGAVANYIPELGKADPAHFGIS
LATLDGHVYEVGDSRVPFTIQSMSKPFVFALALDILGSDAVERVIGVEPSGDPFNSIRLN
ADNHPFNAMVNAGAIACSGLVRGARHADAFETIRDALGRFAGRKLDVDDAVFASEAATGD
RNRAIAYLLRTSGVISEPVDDVLAVYFRQCAVLVTARDCAIMAATLANRGVNPVTGEQVV
TPYAVSRTLSVMTSSGMYDFAGEWIYRVGIPAKSGVGGGILASLPARLGLGSYSPRLDGH
GNSARGIKVCEALSAHYGLHMLNRSDDARTTIIADYDIGASPSRRSRRTQEREILAAHPD
AVRVLELVGTLSLSNVDYVSRQLAAGERPQFVIFDLHRVTAMTPAGLRLLAELFHELADF
HVTVVLSGLRRTSPEWQEITARTGDIRNVRDFYLLDTAIEWAEDQIVYRYGGAIDFLETT
ELAEQPLLAGLSADERHELAALATIRHYQQSERILSAGEAASSLFFLRSGVVHVTLPDGI
RLATLTAGQCFGEMALLESARSADVTADFSATAFEIALDDFERFRARHPRAGERIMRNLA
QLLAERLTIANARLNLLAAD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacactccgcgcccacatcgcaatccgcagcactgggcctccgccgcaatg
cctccgctgcagcgcttcctctcggcctgccacgccgacttctggcccgatcatgacggc
gcggtcgcgaactacattcccgagctgggcaaggcggaccccgcgcatttcggcatcagc
ctcgccacgctcgacggccatgtctacgaggtcggcgacagccgcgtgccgttcacgatc
cagtcgatgtcgaagccgttcgtcttcgcgctcgcgctcgacattctcggctccgacgcc
gtcgagcgcgtgatcggcgtcgagccttccggcgatcccttcaattcgatccggctcaat
gccgacaatcatccgttcaatgcgatggtcaatgccggcgcgatcgcctgcagcggcctc
gtgcgcggggcccggcacgccgacgcgttcgagaccatccgcgacgcgcttggccgcttc
gccggccgcaagctcgatgtcgacgacgccgtattcgcctcggaagcggcgaccggcgac
cgcaaccgcgccatcgcctatctgctgcggacgtccggggtcatcagcgagccggtcgac
gacgtgctcgcggtgtacttccggcaatgcgccgtgctcgtcacggcgcgcgattgcgcc
atcatggcggcgacgctcgccaatcgcggcgtcaatccagtgaccggcgagcaggtcgtg
acgccctatgcggtgtcccgcacgctctcggtcatgacctcgtcgggcatgtatgacttt
gcgggcgaatggatctatcgcgtcggcattccggccaagagcggcgtcggcggcggcata
ctggcgagcctgccggcgcggctcgggctcggcagctactcgccgcggcttgatggccat
ggcaacagcgcgcgcggcatcaaggtctgcgaggcgctgtcggcgcattacggcctgcac
atgctgaatcgctcggacgacgcgcggaccacgatcatcgccgattacgacatcggcgcc
agtccgtcgcggcgcagccgccgcacccaggagcgcgagatcctcgccgcgcaccccgac
gccgtgcgcgtgctagagttggtcggtacgctgtcgctctcgaatgtcgactacgtctcg
cgccagctggccgcgggcgagcgcccgcaattcgtgatcttcgatctgcaccgcgtcacc
gcgatgacgccagccggcctgcgtctgctggccgagctgtttcacgagctcgcagatttc
cacgtcaccgtcgtgctctccggcctccgccggacctcgccggaatggcaggagatcacg
gcgcgcaccggcgacatccgcaacgtgcgcgacttctatctgctcgacactgcgatcgaa
tgggccgaggaccagatcgtctatcgctacggcggcgcgatcgacttcctcgaaaccacc
gagcttgccgagcagccgctgctggccggcctctccgccgacgagcgccacgaactggcc
gcgctggccacgatccggcactatcagcagagcgagcgcatcctgtccgcgggagaggca
gcgagctcgctgttcttcctgcgctccggcgtggtccatgtcaccctgcccgacggcatc
cggctggccacgctgacggcggggcaatgcttcggcgaaatggccttgctcgagtcggca
agatctgccgacgtgacggccgacttctcggcgacagcgttcgagatcgcgctggatgat
ttcgagcgtttccgggcgcggcatccgcgcgccggcgagcggatcatgcgcaacctcgcg
cagctgctggcggagcgcctgacgatcgccaatgcgcggctgaatctgctggctgctgat
tga

DBGET integrated database retrieval system