KEGG   Bradyrhizobium sp. ORS 278: BRADO3139Help
Entry
BRADO3139         CDS       T00516                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00071  Fatty acid degradation
bra00280  Valine, leucine and isoleucine degradation
bra00281  Geraniol degradation
bra00310  Lysine degradation
bra00360  Phenylalanine metabolism
bra00362  Benzoate degradation
bra00380  Tryptophan metabolism
bra00410  beta-Alanine metabolism
bra00627  Aminobenzoate degradation
bra00640  Propanoate metabolism
bra00650  Butanoate metabolism
bra00903  Limonene and pinene degradation
bra00930  Caprolactam degradation
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BRADO3139
   00650 Butanoate metabolism
    BRADO3139
  Lipid metabolism
   00071 Fatty acid degradation
    BRADO3139
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRADO3139
   00310 Lysine degradation
    BRADO3139
   00360 Phenylalanine metabolism
    BRADO3139
   00380 Tryptophan metabolism
    BRADO3139
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BRADO3139
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BRADO3139
   00281 Geraniol degradation
    BRADO3139
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRADO3139
   00627 Aminobenzoate degradation
    BRADO3139
   00930 Caprolactam degradation
    BRADO3139
Enzymes [BR:bra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BRADO3139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 FCD
Motif
Other DBs
NCBI-ProteinID: CAL76937
RhizoBase: BRADO3139
UniProt: A4YSR1
Position
3337568..3338620
Genome map
AA seq 350 aa AA seqDB search
MIVRREGSAGIIRLNRPKAINAMTLEMSIGIDAALDQFEADPAIAVVLLEGAGERGLCAG
GDIRGLYESSKVNGDLGKVFWRQEYIMNARIAAFPKPYVAYMDGLVMGGGVGLSAHGRHR
IVTEKTRLAMPEVGLGFFPDVGGTWLLSRAPGELGAYFGLTGQTMNGPDAIHARFADAVV
ATSNWPALREVLTKVRPGTLSAEIDRLIAGFATGETEGPVAAHQAKIDAWFAHDSMHDVF
AALEADDSDLAASTLKTLKEKSPRGMVVTLKLLRLARGATSLQECLVREYRAALEVFRSD
DFREGVRAAIIDKDRNPKWSPPDVDQVTPEMLAPYLAENGPDELTFPQAR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgttcgccgcgagggatctgcgggcatcatccggctcaaccggcccaaggcgatc
aatgcgatgacgctggagatgtcgatagggatcgacgcggcgctcgatcagttcgaagcc
gatcccgccattgccgtggtcctgctggaaggcgccggcgagcgtgggctgtgcgccggc
ggcgacattcgcgggctctatgagagctcgaaggtcaatggcgatctcggcaaggtgttc
tggcgccaggaatacatcatgaacgcgcgcatcgccgcgttcccgaagccgtatgtcgcc
tacatggacggcttggtgatgggcggcggcgtcggcctctcggcgcatggccggcaccgc
atcgtcaccgagaagaccaggcttgcgatgcccgaggtcggcctcggcttcttcccggat
gtcggcggcacctggctgctgtcgcgcgcgccgggcgaactcggcgcctatttcggcctg
accgggcagaccatgaacggtcccgacgcgatccatgcccgctttgccgatgccgtcgtg
gcgacgtcgaactggccggcgctgcgcgaggtcctgaccaaggtcaggccggggacattg
tcggcggagatcgaccgcctcatcgccggctttgcgactggcgaaactgaaggaccggtc
gccgcgcaccaggccaagatcgatgcgtggttcgctcacgacagcatgcacgatgttttt
gctgcgctggaagccgatgactccgatttggccgcgtcgaccctgaagacactgaaggag
aagtcgccgcgcggcatggtggtgacgctgaaactgttgcggctggcacgcggcgcgacg
tcgttgcaagagtgcctggtgcgtgagtatcgtgccgcgctcgaagtattccgtagcgac
gatttccgcgagggtgtgcgcgccgcgatcatcgacaaggatcgcaatccgaaatggtcg
ccgccggatgtcgatcaggtgacgccggagatgttggcgccgtatctcgccgagaacggc
cctgacgagctgacattcccgcaagcgagataa

DBGET integrated database retrieval system