KEGG   Bradyrhizobium sp. ORS 278: BRADO3141Help
Entry
BRADO3141         CDS       T00516                                 

Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00010  Glycolysis / Gluconeogenesis
bra00620  Pyruvate metabolism
bra00640  Propanoate metabolism
bra00680  Methane metabolism
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO3141
   00620 Pyruvate metabolism
    BRADO3141
   00640 Propanoate metabolism
    BRADO3141
  Energy metabolism
   00680 Methane metabolism
    BRADO3141
Enzymes [BR:bra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BRADO3141
Lipid biosynthesis proteins [BR:bra01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BRADO3141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAL76939
RhizoBase: BRADO3141
UniProt: A4YSR3
Position
3339539..3341266
Genome map
AA seq 575 aa AA seqDB search
MTTFKDARAFLLAHRTDYDAAVKGFRWPDPVPFNWALDWFDAELASDPESRERTALWIFD
AAQDRQTKLSFAALSRRSNQVANFLRGQGLKRGDHLLLLLGNVVPLWETMLAAMKLGVVV
IPATTLLTTDELRDRLERGRAKAVVAAQDQVAKFADLGADDLVRIVVGTTTSTGWLPFDK
AADAAEPFTPDGPTQPDDPMLLYFTSGTTAKPKLVRHSHRSYPVGHLSTMYWLGLQPGDV
HLNISSPGWAKHAWSCFFSPWNAGATVFVVNQPRFDAKGLLAIIKRCGVTTLCAPPTVWR
LFIQEHLADFKVSLREACGAGEPLNPEVIDQVRAAWGLTIRDGYGQTETAAICGNSPGQK
LKIGSMGRPLPGYRVEVADIDGNLASEGEITLALTGERPAGLMQGYQGDDGKLSGADGPR
YRAGDVVFQDEEGYLTFVGRSDDVFKSSDYRISPFELESVLLEHEAVAEAAVVPSPDPIR
LAIPKAYVLLTSGAPRSRATALSIFEHLQQRLAPFKRIRRLELVSELPKTISGKIRRVQL
RRLEHEDNRTDHLRGTEFREEDFPELKTRPSGHEV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattcaaggacgcacgcgcgtttcttttggcgcatcgcaccgactacgatgcc
gccgtaaagggctttcgctggcccgatccggtgccgttcaactgggcgctcgactggttc
gatgccgagctcgcctccgatcccgagagccgcgagcgtacggcgctgtggatcttcgat
gccgcgcaggaccgccagacgaaactgtctttcgccgcgctgtcgcgccgctccaatcag
gtcgccaacttcctgcgtggccaggggctgaagcgcggcgatcatctgctgcttctactc
ggcaatgtcgtgccgctgtgggagacgatgctggcggcgatgaagctcggcgtcgtcgtg
atccccgcgaccacgctgctgaccaccgacgaactgcgcgaccggctggagcgcggccgc
gccaaggccgtggtcgccgcgcaggatcaggtcgccaagttcgccgatctcggcgcggac
gatctcgtccgcattgtcgtggggacgacgacgtccactggttggcttccgttcgacaag
gcggccgatgccgccgagccgttcacgcccgacggaccgacgcagcccgatgatccgatg
ctgctgtacttcacgtccggcacgacggccaagccgaagctggtgcggcacagccaccgc
agctatccggtcggccatctctcgacgatgtactggctcggcctgcagccgggcgacgtc
catctcaacatctcctcgccgggctgggccaagcatgcctggagctgcttcttctcgccg
tggaatgccggcgcgaccgtgttcgtcgtcaaccagccgcgcttcgacgccaagggactg
ctcgcgatcatcaagcgctgcggcgtgacgacgctgtgcgcgccgccgacggtgtggcgg
ctgttcatccaggagcatctcgccgacttcaaggtgtccttgcgcgaagcctgcggcgcc
ggcgagccgctcaacccggaagtgatcgatcaggtccgcgccgcctggggactgacgatc
cgcgatggctacggccagaccgagaccgcggcgatctgcggcaactcgccggggcagaag
ctcaagatcggctcgatggggcggccgctgccgggctatcgtgtcgaggttgccgacatt
gatggcaatttggcgagcgagggcgagatcaccctggcgctcacaggcgagcgcccggcc
ggcctgatgcaaggttatcagggagacgatggtaagctctccggcgccgatggcccgcgc
tatcgcgccggcgacgtcgtgttccaggacgaggagggctatctcactttcgttggccgc
tccgacgacgtgttcaaatcgtccgactaccgtatctcgccgttcgagctcgagagcgtg
ctgctggagcacgaggcggtggccgaggcggcggtggtgccgagccccgatccgatccga
ctggcgattcccaaggcctatgtgctgctgacatccggcgccccgcgctcgcgcgcgacc
gcgctgtcgatcttcgagcatctgcagcagcggctggcaccgttcaagcgcatccgccgg
ctcgagctggtcagcgagctgccgaagacgatctccgggaaaatccggcgcgtgcagctg
cgccggctcgagcacgaggataaccgcacggatcatctgcgcggcacggagttcagggaa
gaggatttcccggaattgaagacacggccatccgggcacgaggtgtag

DBGET integrated database retrieval system