KEGG   Bradyrhizobium sp. ORS 278: BRADO3141Help
Entry
BRADO3141         CDS       T00516                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.26)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bra01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bra00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bra00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bra00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bra00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3339539..3341266
Genome map
AA seq 575 aa AA seqDB search
MTTFKDARAFLLAHRTDYDAAVKGFRWPDPVPFNWALDWFDAELASDPESRERTALWIFD
AAQDRQTKLSFAALSRRSNQVANFLRGQGLKRGDHLLLLLGNVVPLWETMLAAMKLGVVV
IPATTLLTTDELRDRLERGRAKAVVAAQDQVAKFADLGADDLVRIVVGTTTSTGWLPFDK
AADAAEPFTPDGPTQPDDPMLLYFTSGTTAKPKLVRHSHRSYPVGHLSTMYWLGLQPGDV
HLNISSPGWAKHAWSCFFSPWNAGATVFVVNQPRFDAKGLLAIIKRCGVTTLCAPPTVWR
LFIQEHLADFKVSLREACGAGEPLNPEVIDQVRAAWGLTIRDGYGQTETAAICGNSPGQK
LKIGSMGRPLPGYRVEVADIDGNLASEGEITLALTGERPAGLMQGYQGDDGKLSGADGPR
YRAGDVVFQDEEGYLTFVGRSDDVFKSSDYRISPFELESVLLEHEAVAEAAVVPSPDPIR
LAIPKAYVLLTSGAPRSRATALSIFEHLQQRLAPFKRIRRLELVSELPKTISGKIRRVQL
RRLEHEDNRTDHLRGTEFREEDFPELKTRPSGHEV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattcaaggacgcacgcgcgtttcttttggcgcatcgcaccgactacgatgcc
gccgtaaagggctttcgctggcccgatccggtgccgttcaactgggcgctcgactggttc
gatgccgagctcgcctccgatcccgagagccgcgagcgtacggcgctgtggatcttcgat
gccgcgcaggaccgccagacgaaactgtctttcgccgcgctgtcgcgccgctccaatcag
gtcgccaacttcctgcgtggccaggggctgaagcgcggcgatcatctgctgcttctactc
ggcaatgtcgtgccgctgtgggagacgatgctggcggcgatgaagctcggcgtcgtcgtg
atccccgcgaccacgctgctgaccaccgacgaactgcgcgaccggctggagcgcggccgc
gccaaggccgtggtcgccgcgcaggatcaggtcgccaagttcgccgatctcggcgcggac
gatctcgtccgcattgtcgtggggacgacgacgtccactggttggcttccgttcgacaag
gcggccgatgccgccgagccgttcacgcccgacggaccgacgcagcccgatgatccgatg
ctgctgtacttcacgtccggcacgacggccaagccgaagctggtgcggcacagccaccgc
agctatccggtcggccatctctcgacgatgtactggctcggcctgcagccgggcgacgtc
catctcaacatctcctcgccgggctgggccaagcatgcctggagctgcttcttctcgccg
tggaatgccggcgcgaccgtgttcgtcgtcaaccagccgcgcttcgacgccaagggactg
ctcgcgatcatcaagcgctgcggcgtgacgacgctgtgcgcgccgccgacggtgtggcgg
ctgttcatccaggagcatctcgccgacttcaaggtgtccttgcgcgaagcctgcggcgcc
ggcgagccgctcaacccggaagtgatcgatcaggtccgcgccgcctggggactgacgatc
cgcgatggctacggccagaccgagaccgcggcgatctgcggcaactcgccggggcagaag
ctcaagatcggctcgatggggcggccgctgccgggctatcgtgtcgaggttgccgacatt
gatggcaatttggcgagcgagggcgagatcaccctggcgctcacaggcgagcgcccggcc
ggcctgatgcaaggttatcagggagacgatggtaagctctccggcgccgatggcccgcgc
tatcgcgccggcgacgtcgtgttccaggacgaggagggctatctcactttcgttggccgc
tccgacgacgtgttcaaatcgtccgactaccgtatctcgccgttcgagctcgagagcgtg
ctgctggagcacgaggcggtggccgaggcggcggtggtgccgagccccgatccgatccga
ctggcgattcccaaggcctatgtgctgctgacatccggcgccccgcgctcgcgcgcgacc
gcgctgtcgatcttcgagcatctgcagcagcggctggcaccgttcaagcgcatccgccgg
ctcgagctggtcagcgagctgccgaagacgatctccgggaaaatccggcgcgtgcagctg
cgccggctcgagcacgaggataaccgcacggatcatctgcgcggcacggagttcagggaa
gaggatttcccggaattgaagacacggccatccgggcacgaggtgtag

DBGET integrated database retrieval system