KEGG   Bradyrhizobium sp. ORS 278: BRADO3317Help
Entry
BRADO3317         CDS       T00516                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bra00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3511253..3511912
Genome map
AA seq 219 aa AA seqDB search
MAAHDGSFDGVERRGLMFVLSSPSGAGKTTLSRMLIERMPGLQMSVSATTRPMRPGEVDG
RDYHFVDRARFEEMVKRNELLEWATVFDNRYGTPRGPVEAALSAGKDVLFDIDWQGTQQL
REKARQDVVSVFILPPSAADLEKRLHTRAQDSHDVIRGRMSRASHEMSHWAEYDYIVINR
NVDEAFAEVQSILKAERLKRERRTGLTTFVRELQRQLEG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcacgacggaagtttcgatggcgtcgagcggcgcggcctgatgttcgtgctc
tcgtcgccgtcgggcgcgggcaagacgacgctgtcgcgcatgctgatcgagcgcatgccg
ggcctgcagatgtcggtgtcggcaacgacgcggccgatgcgccccggtgaggtcgacggc
cgcgactatcacttcgtcgaccgcgcgcgcttcgaggagatggtcaagcgcaacgaactg
ctcgaatgggcgaccgtgttcgacaaccgttacggcacgccgcgcggcccggtcgaggcc
gcgctgtccgccggcaaggacgtgcttttcgacatcgactggcagggcacgcagcagctg
cgcgagaaggcgcggcaggacgtcgtcagcgtcttcatcctgccgccgtcggccgcagat
ctcgagaagcggctgcacacgcgcgcgcaggactcgcatgacgtgatccgcgggcgcatg
agccgcgccagccacgagatgagtcattgggcggaatacgactacatcgtcatcaatcgc
aacgtcgacgaggcgtttgccgaggtgcagtcgatcctcaaggctgagcggctgaagcgc
gagcgccggaccgggctgacgaccttcgtgcgcgagctgcagcgccagctcgagggctga

DBGET integrated database retrieval system