KEGG   Bradyrhizobium sp. ORS 278: BRADO3321Help
Entry
BRADO3321         CDS       T00516                                 

Definition
(GenBank) putative zinc-containing alcohol dehydrogenase family
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00010  Glycolysis / Gluconeogenesis
bra00071  Fatty acid degradation
bra00350  Tyrosine metabolism
bra00625  Chloroalkane and chloroalkene degradation
bra00626  Naphthalene degradation
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO3321
  Lipid metabolism
   00071 Fatty acid degradation
    BRADO3321
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRADO3321
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BRADO3321
   00626 Naphthalene degradation
    BRADO3321
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRADO3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CAL77115
RhizoBase: BRADO3321
UniProt: A4YT89
Position
complement(3516611..3517669)
Genome map
AA seq 352 aa AA seqDB search
MALMRRQSLVKFDAPLCETIVETPKPQGREVLVRIERCGLCHSDLHIQDGYADLGGGKKL
DTTRGMTLPFTLGHEIAGIVDEVGPDVPKELIGARRAVFPWIGCGQCRDCANGDENLCAK
QRFLGVSIDGGFATHVLVPDAKYLLEYDPLPVNQAATLMCSGVTAYGALKRLVDRPRQRN
LLLIGLGGVGMMGLSFAQAMFKQPISVADLSAAARDTALQNGAATAYDPSEADVIKRILK
ETGGGFDEVVDFAGNEKSMAFAVAVVARGGKIVVSGLMGGQFTLPMVQWVYKRMTIEGFM
VGTLAEGHELMALARAGKIKPPPMREEPMADVQKWIDALRAGQVVGRVVLTN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgatgcgtcgccagtcgctcgtgaagttcgatgcaccgctgtgcgagaccatc
gtcgagacaccgaagccgcaaggacgcgaggttctcgtgcggatcgagcgctgcggcctg
tgccactccgacctgcacattcaggacggctatgccgatctcggcggcggcaagaagctc
gacaccacgcgcggcatgacgctgccctttacactgggccacgagatcgccggcatcgtc
gacgaggtcgggcccgatgtcccgaaggagctcatcggcgcccgccgcgcggtgtttccg
tggatcggctgcggccagtgccgcgactgcgccaatggcgacgagaatttgtgcgcgaag
cagcgcttcctcggcgtctcgatcgacggcggcttcgccacgcacgtgctggtgcccgat
gcgaaatacctgctcgaatatgatccgctgccggtgaatcaggcggccacgctgatgtgc
tccggcgtaaccgcctatggcgcattgaagcgcctcgtcgaccggccgcgccagcgcaat
ctgctgctgatcgggctcggcggcgtcggcatgatgggcctgtcgtttgcccaggcgatg
ttcaagcagccgatctcggtcgcggatctctcggcggccgcgcgcgacacggcgctgcag
aacggcgccgccaccgcctacgatccgtccgaggccgacgtgatcaagcgtattctcaag
gagacgggcggcggctttgacgaggtcgtcgacttcgccgggaacgagaagtcgatggcc
tttgcggtcgccgtcgtcgcacgcggcggcaagatcgtcgtctccggactgatgggcggc
cagttcacgctgccgatggtgcaatgggtgtacaagcgcatgaccatcgaaggcttcatg
gtcggcacgctcgccgaaggtcatgagctgatggcgctggcgcgcgccggaaagatcaag
ccgccgccgatgcgcgaggagccgatggccgacgtgcagaagtggatcgatgcgctgcgt
gccggccaggtggtcggacgggtggtgctgacgaactga

DBGET integrated database retrieval system