KEGG   Bradyrhizobium sp. ORS 278: BRADO3329Help
Entry
BRADO3329         CDS       T00516                                 

Definition
(GenBank) putative DNA polymerase III, chi subunit, HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00230  Purine metabolism
bra00240  Pyrimidine metabolism
bra01100  Metabolic pathways
bra03030  DNA replication
bra03430  Mismatch repair
bra03440  Homologous recombination
Module
bra_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BRADO3329
   00240 Pyrimidine metabolism
    BRADO3329
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BRADO3329
   03430 Mismatch repair
    BRADO3329
   03440 Homologous recombination
    BRADO3329
Enzymes [BR:bra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BRADO3329
DNA replication proteins [BR:bra03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BRADO3329
DNA repair and recombination proteins [BR:bra03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     BRADO3329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: CAL77123
RhizoBase: BRADO3329
UniProt: A4YT97
Position
3527328..3527780
Genome map
AA seq 150 aa AA seqDB search
MTEVLFYHLQSMTLEGVLPPLLEKSLERGWRVVVQSTSEERADALDAHLWTYRDDSFLPH
ATWRVADVAEQPIVLAIEESNPNRANVRFLVDNAPLPSDSQSYERMVLVFNGDDPDALAA
ARSAWTDCKNRGFEVTYWQADERGRWQRRQ
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtcctgttctatcatctgcagagcatgacgctggaaggcgtgctgccgccg
ctgctcgagaagtcgctcgagcgcggctggcgcgtcgtggtgcagtccacctccgaggaa
cgtgcagatgcgctcgatgcgcatctgtggacctatcgtgacgattcgtttctgccgcac
gccacgtggcgcgtggccgatgtggccgagcagccgatcgtgctggcgatcgaggagagc
aatccgaaccgcgccaacgtcaggttcctcgtcgacaacgcgccgctgccgtcggactcg
cagagctatgaacgcatggtgctggtgttcaacggcgacgatcccgatgcgcttgctgca
gcgcggtcggcatggaccgattgcaaaaaccgtggattcgaggtcacctattggcaggcc
gacgaacgcgggcgctggcaacgtcggcaatga

DBGET integrated database retrieval system