KEGG   Bradyrhizobium sp. ORS 278: BRADO3371Help
Entry
BRADO3371         CDS       T00516                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00480  Glutathione metabolism
bra00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BRADO3371
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRADO3371
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BRADO3371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: CAL77162
RhizoBase: BRADO3371
UniProt: A4YTD6
Position
complement(3566081..3566662)
Genome map
AA seq 193 aa AA seqDB search
MMIDRRMVVLGLGASLSGAMIASRVAQAENAAVSKSTAYRFSFPVPSGEPIRLADFAGKP
VLVVNTASQCGYTPQYTGLQKLWSEFHERGLTIIAVPSNDFNQEPGVGGDIAELANKEYG
VTFPMTAKAVVTGSNAHPFYRWAAEARPKDTPRWNFHKYLVGRDGYIADVFASSVEPTDT
RVKTAIARMLAEG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcgatcgcaggatggttgttctcggcctcggcgcgtccttgtccggcgcgatg
atcgcctcgcgcgtcgcgcaggcagagaatgcggcggtgagcaagtcgacggcctaccgg
ttctccttcccggtgccctccggcgagccgattcggctggccgatttcgccggcaagccg
gtgctggtcgtgaacacggcgtcgcagtgcggctacacaccccaatataccgggctgcag
aagctctggagcgagttccacgagcgcggcttgacgatcatcgccgtcccctccaacgac
ttcaaccaggagccgggcgtcggaggcgacatcgccgagctcgccaacaaggaatacggt
gtgaccttcccgatgacggccaaggctgtggtcaccggctccaatgctcatccattctac
cgctgggccgccgaagcgcgtcccaaggacaccccgcgctggaactttcataaatacctg
gtcggccgcgacggctacatcgccgacgtgttcgcgtcctcggtggagccgaccgatacc
cgggtgaagaccgccatcgcccggatgctcgccgaaggctga

DBGET integrated database retrieval system