KEGG   Bradyrhizobium sp. ORS 278: BRADO3548Help
Entry
BRADO3548         CDS       T00516                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
bra  Bradyrhizobium sp. ORS 278
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3739565..3740632)
Genome map
AA seq 355 aa AA seqDB search
MVNALDEHERTMAFAEVALSQIKTLRHSANPRNYEIWYVYATGYNAQLNEIINGTLARNG
RLSQSELDQLYESYLAHLKASDRIDKVGARVVGEIDDLMGMLTDALGRTASYDASLAGAD
RMLASATSREQLVDIIEALAHSTKQMRETNRILEERLSLSKDEISGLQHSLEAIRAESLT
DPLTGLGNRKYFDRMIETAVLTGLATNQPLSLLMFDIDHFKSFNDSYGHLTGDQVLRLVG
LTLKHAVKGQDIAARYGGEEFAVVLPNTALRQALAVADQIRRAVTAKELKKKSTGEILGR
VTISVGVSMLRPGDDTDALIERADACLYAAKHNGRNRVVCESDPEYATATRGQVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaatgcgcttgacgaacacgaacgcacgatggccttcgcggaagtcgcgctcagc
cagattaaaacactccgtcactcggccaatccgcgcaactatgagatctggtacgtctac
gcgaccggctacaatgcgcagctgaacgagatcatcaacggcacgctggcgcgcaacggc
cggctgtcgcagtccgagctcgaccagctctacgaatcctatctcgcgcatctgaaggcg
tcagaccgcatcgacaaggtcggggcgcgcgttgtcggcgagatcgacgacctcatgggg
atgctcacggacgcgctcggccgcaccgcgagctacgatgcgagcctggccggcgccgat
cgcatgctcgcctctgcgaccagccgcgagcagctcgtcgacatcatcgaggcactggcg
cattcgaccaagcagatgcgggagacgaaccggatcctcgaggagcgcctgtcgctgtcc
aaggatgaaatcagcggactgcagcacagcctggaagccattcgcgccgaaagcctcacc
gacccgctgaccggacttggcaaccgcaagtatttcgaccgcatgatcgagacggcggtg
ctgacgggtcttgcgaccaaccagcctttgtcgctgctgatgttcgacatcgaccatttc
aagtcgttcaacgactcctacggtcacctcaccggcgaccaggtgctccgcctggtcggc
ctgacgctgaagcacgcggtcaaggggcaggacatcgccgcgcgttacggcggcgaagaa
ttcgcggtggtgctgccgaacacggcgctgcggcaggcgctggcggtcgccgaccagatt
cgccgcgcggtcaccgcgaaagagttgaagaagaagtcgaccggcgagatcctgggccgc
gtgaccatctcggtcggcgtctccatgctccgccccggcgacgacaccgacgcgctgatc
gagcgcgccgacgcctgcctctatgccgccaagcacaacggccgcaatcgcgtggtgtgc
gagagcgatcccgaatacgcgacagcgacgcgcggccaggtcgcctga

DBGET integrated database retrieval system