KEGG   Bradyrhizobium sp. ORS 278: BRADO3748Help
Entry
BRADO3748         CDS       T00516                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRADO3748 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRADO3748 (aceA)
Enzymes [BR:bra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BRADO3748 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3911810..3913447
Genome map
AA seq 545 aa AA seqDB search
MNFQPRGLNDQALQGSSSYQAEVEAARALLETNPTWNGVTAEAVARMRLQNRFKTGLDVA
RYTAAVMRADMAAYDEDSTKYTQSLGCWHGFIAQQKLISIKKHFGRTDRRYLYLSGWMIA
ALRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADSRELNDLFRTLDAARKAGDKAKETE
IIAKIDGFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQD
GKVTVPHDVFLAKIRACRHAFLELGVEDGIIVTRTDSLGAGLTQQIAYSSQPGDLGDQYN
SFLDCEEVTPETARSGDVIINQNGKMVRPKRLPSNLYQFRPGTGEDRCVLDCITSLQNGA
DLLWIETEKPHIEQIAKMVDRIRKVIPNAKLAYNNSPSFNWTLNFRWQVYDAMKEAGQDV
SKYNRAELMKAEYDDTPLAKEADERIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLA
REYFGEQGMLGYVKNVQRAEIRQGIACVKHQNMAGSDIGDDHKEYFAGEKALKAGGAHNT
MNQFG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccaaccgcgtggactgaacgaccaggctctccaaggctcctcgtcctaccag
gccgaggtcgaggcggcgcgtgcgctgctcgagaccaacccgacctggaacggcgtcacc
gccgaggccgtggcgcgcatgcgcctgcagaaccgcttcaagaccggtctcgacgtggcc
cgctacaccgcggccgtgatgcgcgccgacatggccgcctacgatgaggacagcaccaag
tacacgcagtcgctcggctgctggcacggcttcatcgcgcagcagaagctgatctcgatc
aagaagcattttggccgcaccgaccgccgctacctctatctctccggctggatgatcgcg
gcgctgcgctccgagttcggcccgctgccggaccagtcgatgcacgagaagacctcggtg
cccgcgctgatcgaggagctctataccttcctgcgccaggccgactcgcgcgagctcaac
gatctgttccgcacgctcgacgccgcccgcaaggccggcgacaaggcgaaggagaccgag
atcatcgccaagatcgacggcttccagacccacgtcgtcccggtcatcgccgacatcgac
gccggcttcggcaatgcggaagcgacctatctgctcgccaagaagatgatcgaggcgggc
gcctgcgcgctgcagatcgagaaccaggtctcggacgagaagcagtgcggccatcaggac
ggcaaggtcaccgtgccgcatgacgtcttcctggccaagatccgcgcctgccgccacgcc
ttcctggagcttggcgtcgaggacggcatcatcgtcacccgcaccgactcgctcggcgct
ggtctcacgcagcagatcgcctattcgagccagccgggcgatctcggcgaccagtacaac
agcttcctcgactgcgaggaagtgacgccggagaccgcgcgcagcggcgacgtcatcatc
aaccagaatggcaagatggtcaggccgaagcggctgccctcgaacctctatcagttccgt
cccggcaccggtgaggaccgttgcgtgctcgactgcatcacctcgctgcagaacggcgcc
gacctcttgtggatcgagaccgagaagccgcatatcgagcagatcgccaagatggtcgac
cgcatccgcaaggtcatcccgaacgccaagctcgcctacaacaactcgccgtcgttcaac
tggaccctcaacttccgttggcaggtctacgacgcgatgaaggaggcgggtcaggacgtc
agcaagtacaaccgcgccgagctgatgaaggcggagtatgacgacaccccgctggcgaag
gaagccgacgagcgcatccgcaccttccaggcggattcagccaagcgcgccggcatcttc
caccacctgatcactctgccgacctaccacacggccgcgctctcgaccgacaacctcgcc
cgcgagtatttcggcgagcagggcatgctgggctacgtcaagaacgtccagcgcgccgaa
atccgccagggcatcgcctgcgtcaagcaccagaacatggccggctccgatatcggcgac
gaccacaaggaatacttcgccggcgagaaggccctgaaggccggcggcgcgcacaacacg
atgaatcagttcggctga

DBGET integrated database retrieval system