KEGG   Bradyrhizobium sp. ORS 278: BRADO3748Help
Entry
BRADO3748         CDS       T00516                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRADO3748 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRADO3748 (aceA)
Enzymes [BR:bra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BRADO3748 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3911810..3913447
Genome map
AA seq 545 aa AA seqDB search
MNFQPRGLNDQALQGSSSYQAEVEAARALLETNPTWNGVTAEAVARMRLQNRFKTGLDVA
RYTAAVMRADMAAYDEDSTKYTQSLGCWHGFIAQQKLISIKKHFGRTDRRYLYLSGWMIA
ALRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADSRELNDLFRTLDAARKAGDKAKETE
IIAKIDGFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQD
GKVTVPHDVFLAKIRACRHAFLELGVEDGIIVTRTDSLGAGLTQQIAYSSQPGDLGDQYN
SFLDCEEVTPETARSGDVIINQNGKMVRPKRLPSNLYQFRPGTGEDRCVLDCITSLQNGA
DLLWIETEKPHIEQIAKMVDRIRKVIPNAKLAYNNSPSFNWTLNFRWQVYDAMKEAGQDV
SKYNRAELMKAEYDDTPLAKEADERIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLA
REYFGEQGMLGYVKNVQRAEIRQGIACVKHQNMAGSDIGDDHKEYFAGEKALKAGGAHNT
MNQFG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccaaccgcgtggactgaacgaccaggctctccaaggctcctcgtcctaccag
gccgaggtcgaggcggcgcgtgcgctgctcgagaccaacccgacctggaacggcgtcacc
gccgaggccgtggcgcgcatgcgcctgcagaaccgcttcaagaccggtctcgacgtggcc
cgctacaccgcggccgtgatgcgcgccgacatggccgcctacgatgaggacagcaccaag
tacacgcagtcgctcggctgctggcacggcttcatcgcgcagcagaagctgatctcgatc
aagaagcattttggccgcaccgaccgccgctacctctatctctccggctggatgatcgcg
gcgctgcgctccgagttcggcccgctgccggaccagtcgatgcacgagaagacctcggtg
cccgcgctgatcgaggagctctataccttcctgcgccaggccgactcgcgcgagctcaac
gatctgttccgcacgctcgacgccgcccgcaaggccggcgacaaggcgaaggagaccgag
atcatcgccaagatcgacggcttccagacccacgtcgtcccggtcatcgccgacatcgac
gccggcttcggcaatgcggaagcgacctatctgctcgccaagaagatgatcgaggcgggc
gcctgcgcgctgcagatcgagaaccaggtctcggacgagaagcagtgcggccatcaggac
ggcaaggtcaccgtgccgcatgacgtcttcctggccaagatccgcgcctgccgccacgcc
ttcctggagcttggcgtcgaggacggcatcatcgtcacccgcaccgactcgctcggcgct
ggtctcacgcagcagatcgcctattcgagccagccgggcgatctcggcgaccagtacaac
agcttcctcgactgcgaggaagtgacgccggagaccgcgcgcagcggcgacgtcatcatc
aaccagaatggcaagatggtcaggccgaagcggctgccctcgaacctctatcagttccgt
cccggcaccggtgaggaccgttgcgtgctcgactgcatcacctcgctgcagaacggcgcc
gacctcttgtggatcgagaccgagaagccgcatatcgagcagatcgccaagatggtcgac
cgcatccgcaaggtcatcccgaacgccaagctcgcctacaacaactcgccgtcgttcaac
tggaccctcaacttccgttggcaggtctacgacgcgatgaaggaggcgggtcaggacgtc
agcaagtacaaccgcgccgagctgatgaaggcggagtatgacgacaccccgctggcgaag
gaagccgacgagcgcatccgcaccttccaggcggattcagccaagcgcgccggcatcttc
caccacctgatcactctgccgacctaccacacggccgcgctctcgaccgacaacctcgcc
cgcgagtatttcggcgagcagggcatgctgggctacgtcaagaacgtccagcgcgccgaa
atccgccagggcatcgcctgcgtcaagcaccagaacatggccggctccgatatcggcgac
gaccacaaggaatacttcgccggcgagaaggccctgaaggccggcggcgcgcacaacacg
atgaatcagttcggctga

DBGET integrated database retrieval system