KEGG   Bradyrhizobium sp. ORS 278: BRADO3953Help
Entry
BRADO3953         CDS       T00516                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bra00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bra00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4133392..4134741)
Genome map
AA seq 449 aa AA seqDB search
MLGRIRTVVLWILALLFIVITVNSNEPYLVRLRGGGHAALLIIALAAPLLLLLGGRWRHG
LPGKMLVLAWCIPLIALTSTQFMFAWRKYETFRTAPDVAQLLGRHFMVGYTSLEDAAALA
RQGLIVGVYVTHHNVRGRTAAQLQADIARLQAERISAGLPPLLVSADQEGGSVAHLSPAV
PNMPGLATLADLPSARRMQEAFEMGKSQGRSLAAAGITLNLAPVVDLRPRWTHNRFDFHT
LINRRAISSDPAVVADIALGYVRGLEASGVRAAVKHFPGLGRVAADTHHFSAELDTSAEI
LEQSDWLAFRGVLDKSDAAMMVGHVVVDAIDRERPASHSKAVLDGLIRGRWNYQGIIITD
DLVMGAIYGRNLCEAVVESLSGGADILLVAYDGTQIHRVLACAKRALVDGRIDLEALRRS
DERLGRWMPREDGTVAADASSPRAPAPSK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctcgggcgtatcaggacggtcgtcctctggattcttgctctgctcttcatcgtcatc
acggtcaacagcaacgagccgtatctcgttcgcctgcgcgggggtggtcacgccgccttg
ttgatcatcgctctggccgctccgcttctgctcctgctcggcgggcgatggcggcacggt
ctccccgggaagatgcttgtcctcgcctggtgcatcccgctgatcgcgctgacgtcgacg
cagttcatgttcgcctggcggaagtatgaaacgttccgaacggctcccgacgtcgcgcaa
ttgctcgggcggcacttcatggtcggctatacgtcgttggaggacgctgctgcgctcgcg
cggcagggtttgatcgtcggcgtctatgtgacccaccacaatgtgcgagggcgaacggcg
gcccagctgcaggccgacattgcgcggctacaggccgagcggatcagcgccggcctgccg
cccttgctggtctcggccgaccaggaggggggctcggttgcgcatttgtcgccggccgtg
ccgaacatgcccggccttgcgacgctggccgatctgccgtcagcgcggcgcatgcaagag
gcgttcgagatggggaagagccagggtcggtccttggcagccgccggcatcaccctcaac
ttggcgccggtcgtcgatctccgcccgcgctggacacacaacaggtttgatttccatacg
ttgatcaatcgccgggcgatctccagcgatccggccgtcgtggcggacattgcgctcggt
tatgtccgcggactcgaagcgagcggcgtccgtgccgccgtcaagcacttccccggtctc
gggcgcgttgcggccgacacgcatcatttctctgccgagctcgatacctcagcggaaatt
ctggaacagtcggattggctggcgttccgcggtgtgctcgacaagtcggatgcagcgatg
atggtggggcacgtggtggtcgatgcgatcgatcgcgagcgcccggcgtcgcattcgaag
gccgtgctcgacggcctgatccgcgggcgctggaactaccagggcatcatcatcaccgac
gatctcgtgatgggcgcgatctacggccggaacctctgcgaggccgtggtcgagtccctc
agcggcggtgccgacatcctgctggtggcttatgacggcacgcaaatccatcgtgtgttg
gcttgcgccaaaagggcgttggtggacggacgcatcgatctggaagccctgcgcaggagc
gacgagcgcctggggcggtggatgccgcgggaggacgggactgtcgcggcggatgcatcg
agtccgcgcgcgccggcgccaagcaagtag

DBGET integrated database retrieval system