KEGG   Bradyrhizobium sp. ORS 278: BRADO4082Help
Entry
BRADO4082         CDS       T00516                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BRADO4082
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BRADO4082
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BRADO4082
Enzymes [BR:bra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BRADO4082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4271151..4272392)
Genome map
AA seq 413 aa AA seqDB search
MKSSDNLTTERPTFVTHLECAMVGDHYPADQVHNLSKAGKPLLVRYDLAGVKQALTKDAL
AQRPADMWRYRELLPVRKCQDIVSLGEVMTPLINLPKLAKTLGGGEIIVKDEGRLPTGSF
KARGLVMAVSMGKALGITHMAMPTNGNAGAALAAYATSCGIKTTIFCPADTPEVNVSEIE
LQGATVYRVNGLIDDCGKIVGEGKAKVGWFDTSTLKEPYRIEGKKTMGLELAEQLGWDVP
DVIFYPTGGGTGLIGMWKGFDELEKIGFIGSKRPRMVAVQASGCAPMVRAYEAGVEHATR
WEDAHTIASGIRVPQAVGDFLILRAVRESGGFAIAVDDDAISAGLNEVAREEGLLLCPEG
AATYAAYKQSLADGRVTKTDRVMLFNCATGLKYPLPKVERTLDRHQPIDYTQF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccagcgacaatctcaccaccgagcgcccgaccttcgtcacccatctcgaatgc
gcgatggtcggcgaccattatccggcggaccaggtccacaacctctcaaaggccggcaag
ccgctgctggtgcgctacgatctcgcgggcgtgaaacaggcgctgaccaaggacgcgctg
gcgcagcggcccgcggacatgtggcgctatcgcgagctgctgccggtgcgcaaatgccag
gacatcgtcagcctcggcgaggtcatgacgccgctgatcaatctgccgaagctggcgaag
acactcggcggcggcgagatcatcgtcaaggatgaggggcggctgccgaccggctcgttc
aaggcgcgcggcctcgtgatggcggtgtcgatgggcaaggcgctcggcatcacccacatg
gcgatgccgaccaacggcaatgcgggggcagcgctcgcggcctacgcgacgtcctgcggc
atcaagaccacgatcttttgcccggccgatacgccggaggtgaacgtcagcgagatcgag
ctgcagggcgcgaccgtctatcgcgtcaacggcctcattgatgattgcggcaagatcgtc
ggggaggggaaggccaaggtcggctggttcgatacctcgaccctgaaggagccgtaccgg
atcgaaggcaagaagacgatgggcctggagctcgccgagcagctcggctgggacgtgccc
gacgtgatcttctatccgaccggcggcggcaccggcctgatcggcatgtggaaggggttc
gacgagctggagaagatcggcttcatcggttcgaagcgcccgcgcatggtcgcggtgcaa
gcctccggctgcgcgccgatggtgcgcgcctacgaagccggcgtcgagcacgcgacgcgc
tgggaggatgcgcatacgatcgcctcgggaatccgcgtgccgcaggcggtcggcgacttc
ctcatcctacgcgccgtacgcgagagcggcggctttgccattgcggtcgatgacgacgcg
atttcggccggtctcaacgaggtcgcgcgcgaggaggggctgctgctctgccccgagggc
gctgcgacctacgcggcctacaagcagagcctcgccgacgggcgcgtgacgaagaccgac
cgcgtcatgctgttcaactgcgccaccggactcaaatatccgctgccgaaggtcgagcgc
acgctcgatcgccaccagccgatcgactacactcagttctga

DBGET integrated database retrieval system