KEGG   Bradyrhizobium sp. ORS 278: BRADO4103Help
Entry
BRADO4103         CDS       T00516                                 

Gene name
pyrG
Definition
(GenBank) CTP synthase (UTP--ammonia ligase) (CTP synthetase)
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00240  Pyrimidine metabolism
bra01100  Metabolic pathways
Module
bra_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BRADO4103 (pyrG)
Enzymes [BR:bra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     BRADO4103 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA
Motif
Other DBs
NCBI-ProteinID: CAL77855
RhizoBase: BRADO4103
UniProt: A4YVC9
Position
complement(4292696..4294327)
Genome map
AA seq 543 aa AA seqDB search
MARYIFITGGVVSSLGKGLASAALGALLQARGYKVRLRKLDPYLNLDPGTMSPYQHGEVF
VTDDGAETDLDLGHYERFTGRPATKADNITTGRIYQDILTKERRGDYLGATIQVVPHVTN
AIKDFVLSGNDEYDFVLVEIGGTVGDIEGLPFFEAIRQLGNELPRHHAIYIHLTLLPYIP
SAGELKTKPTQHSVKELRSIGIQPDILLCRTDREIPKEERRKLGLFCNVRESAVIEARDV
DNIYAVPEAYHAAGLDDEVLAAFGIEPRIPPALASWHTINERVRNPEGDVTIAIVGKYTG
MKDAYKSLIEALSHGGIANKVRVKLDWIESEVFENEDPAPFLEHVNGILVPGGFGQRGAE
GKIRAAQFARERDVPYFGICFGMQMAVIEAARNLVGITEANSTEFGPTKEPLVGLMTEWL
RGNELEKRSQSGDLGGTMRLGAYPATLKRGSRVSEVYGGATEISERHRHRYEVNTAYKDR
LEQHGLKFSGLSPDGVLPEIVEYEDHPWFIGVQFHPELKSRPFEPHPLFASFIQAAMVQS
RLV
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggtacatcttcatcaccggcggcgtggtttcctcgctcggaaagggtctggct
tcagccgcgttaggcgcgctgctgcaggcccgcggctacaaggtccggcttcgcaagctc
gacccctatctcaacctcgatccaggcacgatgtcgccgtatcagcacggcgaagtgttc
gtgaccgatgacggcgcggagaccgatctcgatctcggccattacgaacgcttcaccggg
cggcccgcgaccaaggccgacaacatcaccacggggcgcatctaccaggacatcctgacc
aaggagcgccgcggcgattatctcggagcgaccatccaggtcgtcccgcatgtgaccaat
gcgatcaaggatttcgtgctgtcgggcaatgacgagtacgacttcgtgctggtcgagatc
ggcggcaccgtcggcgacatcgagggcctgccgttcttcgaggcgatccgccaactcggc
aacgagctgccgcgccaccacgcgatctacattcatctcacgctgctgccgtacatcccg
agcgccggcgaattgaagaccaagccgacacagcattcggtcaaggagctgcgctcgatc
ggcatccagccggacatcctgctgtgccgcaccgatcgcgagatcccgaaggaggagcgg
cgcaagctcggcctgttctgcaacgtgcgcgagagcgccgtgatcgaggcgcgcgacgtc
gacaacatctacgccgtgccggaggcctatcacgccgccggcctcgacgacgaggtgctg
gccgcgttcgggatcgagccgcggattccgccggcgcttgcgagctggcacacgatcaac
gagcgcgtccgtaatccggaaggcgacgtgacgatcgcgatcgtcggcaagtacacgggc
atgaaggatgcctacaagtcgctgatcgaagcgctgtcccatggcggcatcgccaacaag
gtccgcgtcaagctcgactggatcgagagcgaggtgttcgagaacgaggaccccgcgccg
ttcctggagcacgtcaacggcatcctggtgcccggcggcttcggccagcgcggcgcggaa
ggcaagatccgcgcggcgcagttcgccagggagcgcgacgtgccgtatttcggcatctgt
ttcggcatgcagatggcggtgatcgaagcagcgcgcaatctcgtcggaatcaccgaggca
aactcgaccgagttcggcccgaccaaggagccgctggtcggtctgatgaccgagtggctg
cgcggcaacgaactggagaagcgctcgcagagcggcgatctcggcggcacgatgcggctc
ggcgcctatcccgcgacgctcaagcgcggcagccgcgtgtccgaggtctatggcggcgcc
accgagatctcggagcggcaccgccatcgctacgaggtcaacaccgcctacaaggaccgg
ctcgagcagcatggcttgaagttctccggcctgtcgcccgacggcgtgctgccggagatc
gtggagtacgaggaccatccctggttcatcggcgtccagttccaccccgagctgaagtcg
cgcccgttcgagccgcacccgctgttcgcatcgttcatccaggcggcgatggtgcagagc
cggctggtgtga

DBGET integrated database retrieval system