KEGG   Bradyrhizobium sp. ORS 278: BRADO4107Help
Entry
BRADO4107         CDS       T00516                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRADO4107 (tpiA)
   01230 Biosynthesis of amino acids
    BRADO4107 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO4107 (tpiA)
   00051 Fructose and mannose metabolism
    BRADO4107 (tpiA)
   00562 Inositol phosphate metabolism
    BRADO4107 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRADO4107 (tpiA)
Enzymes [BR:bra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BRADO4107 (tpiA)
Exosome [BR:bra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BRADO4107 (tpiA)
  Exosomal proteins of bladder cancer cells
   BRADO4107 (tpiA)
  Exosomal proteins of melanoma cells
   BRADO4107 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4296215..4296970)
Genome map
AA seq 251 aa AA seqDB search
MTDRIRPLIAGNWKMNGLKASAAEFEAMLAGAAEVTGKADLLVCPPATLLAAFAEKTRGG
KAVAVGAQDCHAKASGAHTGDISAEMLADAGASAVIVGHSERRADHGESDVVVHQKAEAA
WRAGLVAIVCVGETQQQRDAGLTLEILRGQLTLSLPEGSRADNLIVAYEPVWAIGTGLTP
TAGDVEQIHSFIRQLLIVRFKEQGARMRILYGGSVKPSNAAELMAVANVNGALVGGASLK
AADFLAIAKGC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcatccggcccctgatcgccggcaattggaaaatgaatggcctcaaggcg
tcggccgcggagttcgaggccatgctcgcgggggcggccgaggtcaccggcaaggccgac
ctcttggtatgccccccggccacgctgctggcggcgtttgccgagaagacgcgcggcggc
aaggcggtcgcggtcggggcgcaggattgccacgccaaggcgtcgggcgcccatacgggc
gacatctcggccgagatgctggcggatgccggggccagcgccgtcatcgtgggccattcg
gagcggcgggccgaccatggcgagagcgatgtcgtcgtgcaccagaaggccgaggcggcg
tggcgcgccgggctggtcgcgatcgtctgcgtcggcgagacccagcagcagcgcgacgcc
gggctgaccctggagatcttgcgcgggcagctcaccctcagcctgccggagggttcgcgg
gccgacaatctgatcgtggcctatgagccggtctgggcgatcggcaccgggctgacgccg
accgccggggatgtcgagcagattcattcctttatccggcaattgctgatcgttcggttc
aaggagcagggggcgcggatgcggatcctctatggtggctcggtcaagccgtccaatgcg
gccgagctgatggcggtggccaacgtcaatggtgcgctggtcggcggcgcgagcctgaaa
gcagcagactttctcgcaattgcgaaaggctgttga

DBGET integrated database retrieval system