KEGG   Bradyrhizobium sp. ORS 278: BRADO4353Help
Entry
BRADO4353         CDS       T00516                                 

Definition
(GenBank) putative alcohol dehydrogenase (Zinc-containing)(AdhT-like)
  KO
K18382  NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BRADO4353
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BRADO4353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Shikimate_DH Sacchrp_dh_NADP ThiF TrkA_N ADH_N_assoc KR MTS 3HCDH_N Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: CAL78100
RhizoBase: BRADO4353
UniProt: A4YW24
Position
complement(4543684..4544727)
Genome map
AA seq 347 aa AA seqDB search
MKAAVLHAFDEKLTSREFVRYEEVPDPKISRPMDVIVRIGGAGVCRTDLHIVEGIWRSKV
DVKLPYIMGHENAGWVEAVGPGVEGVKVGDSVICHPLVTSGHCLACRRGNDMHALDSSFP
GINANGGYAQYLLTGQRSLIKLPKSLAPKDVAPYTDAGLTAYRAAKKASRHLLPGEYVVV
IGAGGLGHIGIQVLAALCAAEIVVVDRSEKSLELAKTCGAHHLVKAEGGEVEAVLALTGG
RGAEAVIDFVGEGDAVAKGLAMTANGGTYYIVGYGGKIELPTIDMITTEKSIVGNLVGTY
AELVELMALADRGLVTLHTREYRLSEANDALHDLHHGRIHGRAVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgcggtgctccatgcgttcgatgagaagctgacctcgagagagttcgtcaga
tacgaggaggttcccgacccgaagatctcgcgtccgatggacgtgatcgtgcgcatcggt
ggcgccggcgtctgccgtaccgatcttcacatcgtcgagggaatctggcgcagcaaggtc
gacgtcaagctcccctacatcatgggtcatgaaaacgcgggctgggtcgaggcggtcggt
cccggtgtcgagggcgtcaaggtcggtgacagcgtcatctgtcacccgctggtgaccagc
ggccattgtctggcatgcaggcgcggcaacgacatgcatgcgctcgacagtagctttccc
ggcatcaatgccaatggcggctacgcgcaatatctgctgaccggacagcgctcgttgatc
aagctgccgaagtcgctggcgccaaaggacgtcgctccctacacggacgcgggattgacc
gcctaccgcgccgccaagaaagcgtcgcgccacctgctgcctggcgaatatgtcgtggtg
atcggggcaggcggtctcggccatatcggcatccaggttctcgcggcgctatgcgcggcg
gagatcgtcgtcgtcgaccgctccgagaaatcgctggagctcgccaagacctgtggcgcg
catcacctggtcaaggctgagggcggcgaggtcgaggcggtgctggcgctgaccggcggg
cgtggggctgaggcggtgatcgacttcgtcggcgagggcgatgcggtggccaagggactg
gcgatgaccgccaatggcggcacctactacatcgtcggttacggcggcaagatcgagctg
ccgaccatcgacatgatcacgaccgagaagagcatcgtcggcaacctggtcggcacctat
gccgagctggtcgaattgatggcgctcgcggaccgcggtctcgtgacgctgcacaccagg
gaataccggctcagcgaggccaatgatgcgctccacgatctgcatcatgggcgcatccac
ggacgtgccgtgctgattccttga

DBGET integrated database retrieval system