KEGG   Bradyrhizobium sp. ORS 278: BRADO4436Help
Entry
BRADO4436         CDS       T00516                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bra00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4637439..4638500
Genome map
AA seq 353 aa AA seqDB search
MAIKFGRPIDVRDVARNPAAGTPPVLDLTIRPRRNRKAEWARRLVRENVLTTDDLIWPLF
VVQGDRTRSTVASMPGVERLSVDEIVRDAERAAKLDIPCIALFPYTEPSLRDEHGSEACN
PDNLVCQAVRAIKKEFPEIGVLCDVALDPFTSHGHDGLIKDGRILNDETVAVLVRQALVQ
AEAGCDIIAPSDMMDGRVGAIRQALDQSGFLDVQIMAYAAKYASAFYGPFRDAIGSAKTL
TGDKRTYQMDSANTDEALREVELDIAEGADMVMVKPGMPYLDVVRRVKDTFSMPTFAYQV
SGEYAMIAAAANNGWIDGDRAIMESLLAFKRAGADGVLTYFAPQAAERLRRQS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaattcgggcgcccgatcgatgtgcgcgacgtcgcgcgtaaccccgccgcg
ggaacaccaccggtgctcgatttgaccatccgcccccggcgaaaccgcaaggcggaatgg
gcccgccgcctggtccgcgaaaacgtcctgaccaccgacgatctgatctggccgctgttc
gtcgtacaaggcgaccggacccgcagcaccgtcgcgtccatgcccggcgtcgagcggctg
agcgtcgacgagatcgtgcgcgacgccgagcgcgccgccaagctcgatattccctgtatc
gcgctgttcccctacaccgagccgtcgctgcgcgacgagcacggctcggaggcctgcaat
cccgacaatctggtttgccaggcggtgcgcgcgatcaagaaggagttcccggagatcggc
gtgctctgcgacgtggcgctggacccgtttaccagccatggccatgacgggctgatcaag
gacggccgcatcctgaatgacgagaccgtcgcggtgctggtgcgccaggcgctggttcag
gccgaggccggctgcgacatcatcgcgccatcggacatgatggacggccgcgttggcgcg
atccgtcaggcgctggaccagtcgggcttcctcgacgtgcagatcatggcttatgcggcc
aaatatgcctccgccttctacggcccgttccgcgacgcgatcggctcggccaagacgctg
accggcgacaagcgcacctaccagatggacagcgccaacaccgatgaggcgctgcgcgag
gtcgagctcgacatcgccgaaggcgccgacatggtgatggtgaagccgggcatgccctat
ctcgacgtcgtccgccgcgtgaaggacaccttcagcatgccgaccttcgcctatcaggta
tcgggcgaatacgcgatgattgccgcggccgccaacaatggctggatcgacggtgaccgg
gccatcatggagagcctgctggctttcaagcgcgccggcgcagatggtgtcctcacctat
ttcgcgccgcaggccgccgagcggttgcgccggcagagctaa

DBGET integrated database retrieval system