KEGG   Bradyrhizobium sp. ORS 278: BRADO4502Help
Entry
BRADO4502         CDS       T00516                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bra00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bra00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4701291..4702244
Genome map
AA seq 317 aa AA seqDB search
MATSPKSTFVLGHRHLLGIEGLSTADITGLLDLSEEYVELNRQVDKKRTVLRGRTQVNLF
FEASTRTQSSFELAGKRLGADVMNMSVSSSSIKKGETLIDTAVTLNAMHPDILVVRHHAS
GAVELLARKVDGSVINAGDGAHEHPTQALLDALTIRRNKGRIEGLVIAICGDVLHSRVAR
SNILLLNTMGARVRVVAPSTLLPPGIERMGVEVARDMREGLNGADIVMMLRLQRERMNGS
FVPSSSEYFQYFGLDQKKLAYAKPDALVMHPGPMNRGVEIDSIVADGAQSLIREQVEMGV
AVRMAVLEALARNLPNA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctctccgaaatcgacgtttgtcctcgggcaccggcatttgctgggaatcgag
ggcctttccaccgccgacatcaccggtctcctcgatctgtccgaggagtatgtcgaactg
aaccgtcaggtcgacaagaagcgtaccgtgctgcgcggccggacccaggtcaacctgttc
ttcgaggcctcgacgcggacgcaatcctcgttcgagctggccggcaagcggcttggcgcc
gacgtcatgaacatgtcggtgtcgtcctcgtcgatcaagaagggcgagaccctgatcgac
accgcggtcacgctcaacgccatgcatccggacatcctggtggtccgtcaccacgcctcc
ggcgcggtcgagctcttggcccgcaaggtcgacggctccgtgatcaatgccggcgacggc
gcgcatgagcatccgacgcaggcgctgctggatgcgctcaccatccgccgcaacaagggc
cgcatcgagggcctggtcatcgcgatctgcggcgacgtgctgcattcgcgcgtcgcgcgc
tccaacatcctcctgctgaacacaatgggcgcccgcgtccgcgtcgtcgcgccctccact
ttgctgccgccgggcatcgagcggatgggcgtcgaggtcgcgcgcgacatgcgcgaaggc
ttgaacggcgccgacatcgtcatgatgctccgcctgcagcgcgagcgcatgaacggctcc
ttcgtgccgtcgtcgtcggaatatttccagtatttcggcctcgaccagaagaagctcgct
tacgccaagccggacgcgctcgtcatgcatccgggaccgatgaaccgcggcgtcgagatc
gactccatcgtcgccgacggcgcgcagtcgctgatccgggaacaggtcgaaatgggcgtc
gccgtgcgcatggccgtgctcgaggcgctggcccgcaacctgcccaacgcttga

DBGET integrated database retrieval system