KEGG   Bradyrhizobium sp. ORS 278: BRADO4822Help
Entry
BRADO4822         CDS       T00516                                 

Definition
(GenBank) putative asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00250  Alanine, aspartate and glutamate metabolism
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRADO4822
Enzymes [BR:bra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BRADO4822
Peptidases [BR:bra01002]
 Cysteine Peptidases
  Family C44
   BRADO4822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: CAL78548
RhizoBase: BRADO4822
UniProt: A4YXC2
Position
complement(5024849..5026789)
Genome map
AA seq 646 aa AA seqDB search
MCGIAGIIGRLDDDNRAALQRMNGAMLHRGPDAGGTWASEPDERGWGALLGHRRLAILDL
SPAGVQPMTDPVTGHVIVFNGEIYNFADLRERLVAGGQRFTSTGDTAVMLRALGLHGPEA
VAWLRGMFAFACWDPGQRQLLLARDPLGIKPLYVARAVNHDAGWSVAFASELRALLASGL
LGTPRLDPEAVASGVWNGFVVGPGTAVKGVELLPPGHLTAFDGVGNTVRDEDFWTIPPLA
PEQGMDEEQLTDILEETLRLHLASDVPLAVFLSGGIDSSVMANLAQRAAPNPIHTFTLAF
EEQELNEGPIARRIATALGTEHHEVVLTEQHFVDNLDAALDSLDQPTFDGLNAYYMSHAI
RSAGFTVALSGTGGDELFGGYTSFRDLPVLQQWSQRTSWMPGGLKVAAATLASRMLSPSG
GAVAAQTRWAKLPDMVRRGDDLLALYQMAYALFLPGFQRELLAPDVAATVSDGLPAAMKA
KITAETRSRTPLSAISVMEQRLFLGERLLRDNDVASMAASLEQRVPLVDQVLLEAVDRLP
DQSRYEPLRSKAMLRRIGLRGLDLSMFDRPKSGFVLPMDRWIRRGLQDAMDQTLRDPQAT
APVGLDPAAVERLWRAFLDGAPGLYWSRVWSIYVFVRWCHRHRVFR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgctggaatcatcggacggctggacgacgataaccgcgcagcgctgcag
cgcatgaacggtgccatgctccatcgcggtccggatgccggcggcacgtgggcctcggag
ccggacgagcgcggctggggggcgttgctgggacatcgccggctggcgatcctggacctg
tcgccggccggcgtgcaaccgatgacggatccggtgaccgggcacgtcatcgtcttcaac
ggcgagatctacaatttcgctgatctgcgcgagcgcctcgtcgccggcggacagcggttc
acatcgaccggtgacaccgccgtgatgttgcgcgccctcggcctgcatgggccggaggcc
gtggcctggctgcgcggcatgtttgcctttgcctgctgggatccgggccagcgccagttg
ctgctggcgcgcgacccgctcggcatcaagccgctctatgtggctcgcgctgtgaaccac
gacgccggctggtcggtggccttcgcatcggaactgcgcgcgctgctggcgtcagggctt
ctcggcacgccaaggctcgaccccgaggcggtcgcgagcggcgtttggaacggcttcgtg
gttggtcccggcacggcggtgaagggcgtcgaactgcttccgcccggtcatctgacggct
ttcgacggcgtcggcaacaccgtgcgcgacgaggatttctggaccatccctccgctcgcg
ccagagcaggggatggacgaggagcaactcacggacatccttgaggagacgctgcgactg
catctcgccagcgacgtgccgctggccgtctttctctccggcggcatcgattcctccgtc
atggccaatctggcccagcgcgcagccccaaatccgatccataccttcacgctggccttc
gaggagcaggagctcaacgaagggccgatcgcgcggcgcatcgccacggcgctcggcacc
gagcatcacgaggtggtgctgaccgagcagcacttcgtcgacaatctcgacgccgcgctc
gacagcctggatcagccgaccttcgacggtctgaacgcctactacatgtctcacgccatc
cgcagcgccgggttcacggtggccttgtcgggcacggggggcgacgaactgttcggcggc
tatacgtcattccgcgacctgccggtcttgcagcaatggtcgcagcgcacatcttggatg
ccgggcggcctgaaggtcgcggccgcaaccctggcctcacggatgctgtcgccgtccggc
ggggccgttgccgcgcagacgcgctgggccaagctgccggacatggtccggcgcggcgat
gatctgctggcgctctatcagatggcctatgcgctgttcctcccgggcttccagcgcgag
ctgctcgcgcccgacgtcgccgcgacggtgagcgatggcctgccggcggcgatgaaggcg
aagatcaccgctgagacgcgctctcgcacgccgctgtcggcgatcagcgtcatggagcag
cgcctgttcctcggcgagcggctgcttcgcgacaatgacgtggccagcatggctgcctcg
ctggagcagcgcgtgccgctggtcgatcaggtgctgctcgaagcggtcgaccggctgccc
gatcagtcgcgctacgagccgttgcgcagcaaggcgatgttgaggcgcatcggcctccgt
gggctcgatctctcgatgttcgaccggccgaagagcggcttcgtgctgccgatggatcgc
tggatccgacgcggcctgcaggatgcgatggaccagaccctgcgcgacccgcaggccacg
gcgcccgtcggtctcgaccccgcagcggtggaacgcctctggcgcgcattcctcgacggt
gcgccgggactgtattggtcgcgcgtgtggtcgatctatgtgttcgtccggtggtgccat
cggcaccgcgtgttccgctga

DBGET integrated database retrieval system