KEGG   Bradyrhizobium sp. ORS 278: BRADO5042Help
Entry
BRADO5042         CDS       T00516                                 

Definition
dihydrokaempferol 4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BRADO5042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5232515..5233543)
Genome map
AA seq 342 aa AA seqDB search
MSEVLVTGGSGFIATHVILQLLAAGHRVRTTLRTPDRQSEVLAALARGGATDPHLLSFHA
ADLTRDDGWAAAVSGCDYVLHIASPLPDHVPDDENELIVPARDGTLRVLRAARDAGVTRV
VLTSSFSAVAYGHRPRAKPFDEADWTDLDGPDVQPYPKSKTLAERAAWAFLASEGGALEL
ATICPVAVLGPVLGPDFSPSIALVQAMLQGRAPAAPRIHLGLVDVRDVADLHLRAMTDPA
ARNERFLAVAGSPLSILEIATVLRTRLGNAGRRAPRRELPNWLARIVALAVPQLRDVKPL
LGLRRTASSDKARRLLGWNPRPNDEIIAATAESLLRLGLVRP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggttctggtcaccggtggctccggcttcatcgcgacgcatgtcatcttgcag
ctgctcgcggccggccatcgcgttcgcaccacgctgcgcacccccgaccggcagagcgag
gtgctggccgcgctcgcccgcggcggcgcgaccgatccccatttgctgtcgttccacgct
gccgatctgacccgggatgacggctgggccgcggcggtgtcgggctgcgactacgtcctc
cacatcgcgtcgccgctgcccgaccacgtgcctgacgacgagaacgagctgatcgtgccg
gcacgcgacggcacgttgcgggtgctgcgggcggcgcgcgacgccggcgtgacgcgcgtg
gtgctgacttcctccttctccgccgtcgcctatggccatcgcccccgcgcaaaaccgttc
gacgaggccgattggaccgatctcgacggtcccgacgtgcagccttacccgaagtccaag
accctggccgaacgcgccgcctgggcgtttctcgccagcgagggcggcgcgttggagctt
gcgaccatctgtccggtcgccgtgctcggcccggtgctgggcccggatttttcgccctcc
attgcgctggtgcaggcgatgctgcagggcagggcgccggccgcgcccaggatccatctc
gggctggtcgacgtccgcgacgtcgccgacctgcatctgcgtgcgatgaccgaccccgcc
gcccgcaacgagcggttcctggcggtggccggttcgccgctgtcgatcctcgagatcgcg
accgtgctgcggacacggctgggcaacgcgggacgacgggcgccgcggcgcgagctgccg
aactggctggcccgtatcgtggcgctcgccgtaccgcaattgcgcgacgtcaagccgctg
ctcggcctgcgccgcacagcctcgagcgacaaggcgcgtcggctgctcggctggaatccg
cggccgaatgatgagatcatcgcagcgacggccgagagcctgctgaggctgggcctggtg
cggccgtga

DBGET integrated database retrieval system